(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01110

AM920435.PC20G01110  Location/Qualifiers
FT   CDS_pept        join(254424..254430,254587..255023)
FT                   /gene="Pc20g01110"
FT                   /locus_tag="PCH_Pc20g01110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01110"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85440"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGS5"
FT                   /protein_id="CAP85440.1"
FT                   /translation="MKSKYVDRGKHEAEKSQDATPNPGSEVHSTGDDEAVAGASASSPL
FT                   EDDDAASLKRKRNGTLNVDGAEDGASSPSKRQKSTPPPPPPPPPPADLPQDDADGDTSM
FT                   GNTGNDSSHPKDDSGAGVDVNMEIEAENNPQTERPQISVEGQV"
     atgaaatcca aatacgtgga tcgcgggaaa cacgaggccg agaagtcgca ggacgctact        60
     ccgaaccccg gaagcgaagt tcacagcacg ggtgacgatg aagccgttgc gggtgcatct       120
     gcgagttctc ccctggaaga cgatgacgct gcatcgctca aacgcaagcg gaacggaacg       180
     ctgaacgttg acggtgctga agatggagca tcctctccgt ctaagcgaca gaaatctaca       240
     cctccaccgc ctcctcctcc gccccctcca gcggatcttc ctcaagatga tgccgacggt       300
     gataccagca tgggaaacac tgggaatgac tcttcacatc cgaaagacga ctccggcgct       360
     ggagtcgacg tcaacatgga gatagaagcg gagaataacc cacaaacgga gcgacctcaa       420
     atcagtgtcg agggacaagt ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page