(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01140

AM920435.PC20G01140  Location/Qualifiers
FT   CDS_pept        complement(263597..264763)
FT                   /gene="Pc20g01140"
FT                   /locus_tag="PCH_Pc20g01140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_38_scaffold_2.tfa_240wg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85443"
FT                   /db_xref="GOA:B6HH39"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH39"
FT                   /protein_id="CAP85443.1"
FT                   /translation="MPHLSYSLAAASLLATFIVTILSGICYATSKASPDVASTILSAVS
FT                   CMALIALGLLHHQNIQTGRRLWICFAGGYLLIAAAASAGAMARSPQASVFVVRSVFWAL
FT                   SVFAQGLYCGFLAMTLAQEKSNPQWPRAYSQEVHSQELKDIPQSPNFLPSPPRVCDLSE
FT                   LFEPKRSSLRKFPRRSSRYSDTTLCPTSTKEEKNASIDNSSSTHTSPSPSPTRDRMPDT
FT                   LPDRDTRPLLRGTHSIRSMPSLRRNPPTALPLDSRVHPSMPSPTASTIRIDSPTQSSSN
FT                   NSTWEYNPFSENNIHPLFRSTSPCPSPTFSPGTMVKASPSAGQTITAGTITRMRSARSL
FT                   HDHAMRAPSPLPGSESEETIRTRPNPTLGFAHSQSVKRYDLNESPYEK"
     atgcctcacc tatcttactc actggcagca gcctccttgc tcgcaacatt cattgtcacc        60
     attcttagtg gtatctgcta tgcaacctca aaagcatcgc ccgatgtggc ctcgactatc       120
     ctaagtgcag taagctgcat ggctttgatt gcccttggtc tgctgcacca tcaaaatatc       180
     caaacgggcc gccgactatg gatatgtttc gctggcggat atctactcat tgccgctgca       240
     gcatctgccg gagcaatggc aaggagtcct caagcctcgg tctttgtggt tcgctctgtg       300
     ttctgggcac tatcagtgtt cgcacaaggt ctatactgtg gattcctcgc gatgacacta       360
     gcccaggaga aatccaaccc tcaatggccg cgtgcctact cacaagaggt tcactcccaa       420
     gagctcaagg atatcccaca aagccctaac ttcctcccat caccccctcg agtatgcgac       480
     ttgtccgagc tattcgaacc caaaagatcc tcactccgca aattccctcg acggtccagc       540
     cgctactcag acacaacact ctgtcctaca agcacaaagg aagaaaagaa cgccagcatc       600
     gacaacagct cctcaacaca cacttcacca agtccatccc cgacacgcga cagaatgcca       660
     gacacactcc cagaccggga cactcgcccc ctcctccgag gcacacacag catccgtagc       720
     atgcccagcc tacgccgcaa tcccccaact gcactcccct tagacagtcg agtacatcca       780
     tcaatgccct cgccaacagc atcaacaatc cgcatcgact ccccaacaca gtccagctcg       840
     aacaactcca cgtgggagta taacccattc agcgagaaca acatccaccc tctcttccgc       900
     tcaacaagcc cctgtccatc cccaaccttc tccccgggga cgatggttaa agcctcaccg       960
     agcgcaggac aaaccatcac ggcggggacg atcacgcgca tgagatctgc tcgctccctc      1020
     cacgaccatg ccatgcgtgc gccttcccca ttgcctgggt cggagtcgga ggagaccatc      1080
     cgcacaagac cgaatccaac tcttggtttt gcgcattcac aatcagtgaa gagatatgac      1140
     ttgaacgaat ccccttatga aaaatga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page