(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01170

AM920435.PC20G01170  Location/Qualifiers
FT   CDS_pept        join(271717..271795,271824..271909,271970..272137,
FT                   272189..272362)
FT                   /exception="reasons given in citation"
FT                   /gene="Pc20g01170"
FT                   /locus_tag="PCH_Pc20g01170"
FT                   /note="putative sequencing error"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig5_part_ii.tfa_3150cg - Aspergillus fumigatus
FT                   [putative sequencing error]"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR041577"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH42"
FT                   /inference="protein motif:PFAM:PF03931"
FT                   /inference="protein motif:PFAM:PF01466"
FT                   /inference="protein motif:COGS:COG5201"
FT                   /protein_id="CAP85446.1"
FT                   /translation="YKDLFRAELPTALPLEYNIAYKIDIGTYIPININVYRLSFKKLDE
FT                   XARXVKDLIKKGLIRESNSVXGFLVVFAXKPNRKXRIYIDYRALNNIIVKNGYPLPRIX
FT                   ELLDIIGNVRILSKIDLIAGYXXIRIGEGSIEKIVFNTIXGKYEXLAIPFRLYNAPTTF
FT                   XSIINKTLXPLFSYNIVVYLDDILIFLATLDKYRKYIEEVLALLXKXXLYVLPTKCTFA
FT                   TXELEFYSYIVRNRTIRPLPAKVEAIXAXPRLKTIYNVYXFLGLATYYYRFVYNFLKVY
FT                   ILLYKLLKESDSTLYKXRFRPITXIEAYKSAFRKVKDLLTSALVLKXLDRNRLYVIEID
FT                   TSEXALSIVLIXEDDNRKLHLVIYNRRKLYSAELNYPIYKKELLAIKEAIYIXDRYIDR
FT                   DRFETVIITDNTSLXYLNTIREYSKRLARXIAEFXXYRLSIRYRKGSENVIADTISRRL
FT                   DLIGTT"
     atgagctcca tcaccctcac cagctccgat ggagtcgata tctctgtcgg taaggataac        60
     ttccacacag caggctgtca gcgcaccact gctgagcgct ccgtcctgat caagaacatg       120
     ctcgaggatc ttggtgattc tggagaggct atccccatcc ccaacgttaa cgaggccgtc       180
     ctcaagaagg tcatcgagtg gtgcgaacac cacaagaacg atccccccag cgccagcgat       240
     gatgacgaca accgtcgcaa gaccaccgat atcgatgagt gggaccagaa attcatgcag       300
     gtggaccagg agatgctttt cgagatcatc ctcgctgcca actacttgga tatcaaggcc       360
     ctccttgacg tcggctgcaa gaccgtcgct aacatgatca agggcaagtc cccggaggag       420
     atccgcaaga ccttcaacat ccagaatgat ttcactcccg aggaggagga ccagatccgc       480
     cgcgagaacg agtgggctga ggagtaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page