(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01190

AM920435.PC20G01190  Location/Qualifiers
FT   CDS_pept        join(273853..274014,274059..274124,274236..274358)
FT                   /gene="Pc20g01190"
FT                   /locus_tag="PCH_Pc20g01190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01190"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85448"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH44"
FT                   /protein_id="CAP85448.1"
FT                   /translation="MANVFFENGGNRSLTYRHLEGLIATASLLDGRMKLSTFECGWFVC
FT                   GRAWLRFGWAETISAKWVNFYECSVYAHTAQDRWKQSSYNAICVLQCQAVLYCRISKLA
FT                   LEALIRNLVSRE"
     atggcgaatg tatttttcga gaatggcggg aacaggagtc taacataccg gcatcttgaa        60
     gggttgatcg cgacggcgag cttgttggat ggacggatga agttatcgac cttcgagtgt       120
     ggatggtttg tgtgcggcag ggcttggctt cgcttcggtt gggcagaaac aatttccgca       180
     aagtgggtca acttctacga gtgttccgta tacgctcaca ctgcccagga tcgttggaaa       240
     cagtcgagct acaatgcaat ttgcgtcctg caatgtcagg ctgttttgta ctgccgcata       300
     agcaagctag ccctggaggc cttgattcgg aacctcgtaa gccgtgaata a                351
//

If you have problems or comments...

PBIL Back to PBIL home page