(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01240

AM920435.PC20G01240  Location/Qualifiers
FT   CDS_pept        join(283390..283503,283554..283631,283702..284532,
FT                   284598..285041)
FT                   /gene="Pc20g01240"
FT                   /locus_tag="PCH_Pc20g01240"
FT                   /note="Title: strong similarity to hypothetical membrane
FT                   protein Ytp1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01240"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85453"
FT                   /db_xref="GOA:B6HH48"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH48"
FT                   /inference="similar to AA sequence:PIR:S59812"
FT                   /protein_id="CAP85453.1"
FT                   /translation="MAYLRQSLWTLSVLVASALAHGGHEAVPEGESISQDPIDSTLWTH
FT                   MILMGLAFGIIFPTGMVLGIIRSRWHVPVQVVGTVIAVLAYFLGHAHKGRQFDKNVHAS
FT                   VANWLMLLLVAQVVLGFYLKLHLEKAGQARIRWIFVLAHGIVGKVMPVLSWAQMLFGGI
FT                   ASLGFCRDDHLGQCLAHFIMGSAFIGYGICLTILLLVGQYWLRRTGRSQEFFDSLIIAA
FT                   WGCVNTFTEHRWGSPWAHNDLQHTTMGIIWWCAGLLGMWLSRTRSGRPKRNLIPAIVIL
FT                   ITGYAMSAHPQSLMISTMIHSIFGYTLMAAGLTRIIEISFVLKDKPALSEPNSFQYLTP
FT                   FLLYASGFLFMGATEEQMLLLHNAGVTHVSYVLILYSIAFIVFLCKLIPYPPLIFSGTP
FT                   THSSLPVVNILLHIYAVHAWPNSESTNQDGPMYSTLNGNANGRARSNSQQIQDAEAFEL
FT                   HGLISDDEEGPSMGPRKNSDEELGKEETRH"
     atggcatatc ttcgccagtc cttatggact ttgtctgtat tagtggcctc ggctctcgcc        60
     catggcggcc acgaggctgt tcctgagggc gaatctatct cccaggatcc tatcgactca       120
     acactatgga ctcatatgat tctcatgggg ttagcttttg gcataatctt cccaacggga       180
     atggttcttg ggataatccg ctcccgctgg catgtccccg tccaagtcgt cggcaccgtc       240
     atcgccgtgt tagcctactt cctcggccac gcccacaaag gccgccaatt cgataagaac       300
     gtgcacgcct ctgtcgcaaa ctggctgatg ctattgctgg tcgcgcaagt cgtcctcggg       360
     ttctatctca agctgcatct tgagaaggcg ggccaggctc gcatccggtg gatcttcgtg       420
     ttggcccatg gcatcgtcgg caaggtcatg cccgtcctca gctgggcgca gatgctattc       480
     ggcggcattg cctcgctcgg cttctgtcgc gatgatcacc tcggtcaatg tctggcccat       540
     ttcatcatgg gctccgcctt catcgggtac ggtatctgtt tgaccattct cttgcttgtc       600
     ggccagtatt ggttgcgccg taccggtcgt agtcaggagt tcttcgattc gcttatcatc       660
     gccgcttggg gctgtgttaa tactttcacc gagcaccgct ggggttcccc ctgggctcac       720
     aatgacctcc agcataccac tatgggaatt atttggtggt gcgctggtct gctgggtatg       780
     tggctcagcc gtacccgcag cggccgccct aagcgtaacc tcattccggc cattgtcatc       840
     ttgattaccg gttatgccat gtccgcccac ccccagtcgc tgatgatcag tactatgatc       900
     cactccatct tcgggtatac cctgatggcg gcgggcctga cgcgcatcat tgagatctcg       960
     ttcgtgctaa aggataagcc tgctctctcc gagccgaaca gcttccaata cctgactccc      1020
     ttcttgctct acgcctccgg tttcctcttc atgggtgcca ccgaggagca gatgctcctg      1080
     ctgcacaacg caggtgtcac tcacgtgtcc tacgtcttga tcctctacag cattgccttc      1140
     attgtcttcc tctgtaagtt gattccctac ccaccactta tcttttctgg aacacccact      1200
     cattcttctc ttccagtcgt caacatcctt ctccacatct acgctgtcca cgcctggccc      1260
     aactccgagt ccaccaacca ggatggcccc atgtactcca ctctcaacgg gaacgcgaat      1320
     ggtcgtgcgc gttcaaactc gcagcagatc caagatgccg aggcattcga gctccatggc      1380
     ttgatttctg atgatgagga gggtccttct atgggaccgc ggaagaatag cgatgaggaa      1440
     cttggaaaag aagagacccg tcactga                                          1467
//

If you have problems or comments...

PBIL Back to PBIL home page