(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01280

AM920435.PC20G01280  Location/Qualifiers
FT   CDS_pept        complement(join(293362..293432,293524..293676,
FT                   293958..294149,294226..294298))
FT                   /gene="Pc20g01280"
FT                   /locus_tag="PCH_Pc20g01280"
FT                   /note="Title: similarity to hypothetical v-snare binding
FT                   protein SPAC56F8.07 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01280"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85457"
FT                   /db_xref="GOA:B6HH52"
FT                   /db_xref="InterPro:IPR016964"
FT                   /db_xref="InterPro:IPR033118"
FT                   /db_xref="UniProtKB/TrEMBL:B6HH52"
FT                   /inference="similar to AA sequence:PIR:T38917"
FT                   /protein_id="CAP85457.1"
FT                   /translation="MSICTRKRDLAYLLFFVTHVPIILLIDTVPLLPSFLQTNLSHQLR
FT                   EFYITTYRDKFFEDPPTWFTVFIWMELLYHLPVSIWAARGLLKDHPLVPVHLLVFGIQA
FT                   FITTLTSLVVVWSWTDRSVAEKQQLTTLYAPYMALGGFMALDMVFRLRDKLMPKTKRE"
     atgtccatct gcactcgtaa acgggacttg gcctatctcc tctttttcgt cacccatgtc        60
     ccgatcattc tcctaattga cacagtccct ctcctaccat ccttcctcca aacaaatctc       120
     tcccaccagc tgcgcgaatt ctacataaca acctaccgcg acaaattctt cgaagacccc       180
     ccaacatggt tcaccgtctt catctggatg gagctgctgt accacctccc agtctcgata       240
     tgggcagctc ggggtctgct taaagaccac cccctcgtcc ctgtgcatct cctcgtcttc       300
     ggtattcaag ccttcatcac cacgctgacg tctctggtgg ttgtgtggag ttggaccgac       360
     cgttcggtcg cagagaagca gcagcttacc acgctgtatg ctccgtatat ggcgttaggc       420
     gggttcatgg ctctagacat ggtattccgt ctacgcgaca aactaatgcc gaaaactaag       480
     cgcgaataa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page