(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01310

AM920435.PC20G01310  Location/Qualifiers
FT   CDS_pept        join(301664..301803,301856..302255)
FT                   /gene="Pc20g01310"
FT                   /locus_tag="PCH_Pc20g01310"
FT                   /note="Title: similarity to hypothetical conserved protein
FT                   VC0519 - Vibrio cholerae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01310"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85460"
FT                   /db_xref="GOA:B6HD68"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD68"
FT                   /inference="similar to AA sequence:PIR:G82312"
FT                   /inference="protein motif:COGS:COG1610"
FT                   /protein_id="CAP85460.1"
FT                   /translation="MFQSIRFSSRLPARLVRWNSTGPALPPLMATLRTDLKTAMRAKDT
FT                   TRLNVLRALISETNNAAKTASPIQTDIQLLSLIRKRLNASKDAAKEFAAAERPDLKEKE
FT                   DAQVVVLEEYASQVKTLPIAEIKEVVINEIAAMVNANTKPNQGTVLKALFAPGGPLDGK
FT                   PVDRKEVATEVKNALS"
     atgtttcaat ctattcgttt ttcttcacgc ctaccagctc gtctggtacg gtggaattcc        60
     accggtccgg ccctgccacc cttgatggct actttgcgga ctgatctgaa aactgctatg       120
     agagccaaag acaccacaag actgaatgta cttcgtgctc tgatctctga gaccaacaac       180
     gccgccaaaa ccgcctcgcc aattcaaaca gacattcagc tcttgtcgct aatccggaaa       240
     cgcctgaacg cgtctaaaga tgcagcaaag gagtttgctg ccgctgaacg tccagatctg       300
     aaggagaaag aagatgcaca ggttgtggta ttggaggaat atgctagtca ggtcaagacc       360
     ctccccattg ccgagatcaa agaagtggtc atcaacgaga tcgctgctat ggtcaatgcc       420
     aatacgaagc ccaaccaagg aaccgttctc aaagctctgt ttgctccagg aggccctctc       480
     gatggcaagc cagtggaccg gaaagaagtt gctaccgagg tgaagaacgc gctctcttga       540
//

If you have problems or comments...

PBIL Back to PBIL home page