(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01410

AM920435.PC20G01410  Location/Qualifiers
FT   CDS_pept        complement(join(318142..318248,318458..318653))
FT                   /gene="Pc20g01410"
FT                   /locus_tag="PCH_Pc20g01410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85470"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD78"
FT                   /protein_id="CAP85470.1"
FT                   /translation="MRDMTILLQDGKFGQFASAQVLVPHNPLYSVPHTQAMTSFVWRFS
FT                   RPFGEGGRDFQGWMLISGVASTKALGLAGPNIRQKAMRHATPEQRAAQISLSACL"
     atgcgtgaca tgactattct cttgcaggat ggaaaattcg gtcaattcgc atccgcacaa        60
     gtacttgtcc cacataatcc gttatacagc gtgccacaca cgcaggcgat gacttcattt       120
     gtatggaggt tctctcggcc attcggagaa ggaggccgag acttccaagg ttggatgcta       180
     ataagcggag tagccagcac caaagcgttg gggctggccg gacccaacat tcgccagaaa       240
     gcgatgaggc acgccactcc cgagcaaagg gcagcgcaaa tctctctcag cgcttgctta       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page