(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01430

AM920435.PC20G01430  Location/Qualifiers
FT   CDS_pept        complement(321911..322465)
FT                   /gene="Pc20g01430"
FT                   /locus_tag="PCH_Pc20g01430"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An12g06840 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01430"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85472"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD80"
FT                   /protein_id="CAP85472.1"
FT                   /translation="MSEPISRTEARQKSADIKKKQAETLAGLPPGSLHISLYIRSDPPL
FT                   PNDFHWAFYLHNGTSSTPGGTKYHARGVGGGWIAGHEATAGIFTENFLCVVIQIATIPP
FT                   SAHERVDEIMRSYDGSLNSIPGITCRVWILTILRILVDEGFVHCDIGELEKDCFEFGNE
FT                   HSATASANQQPRPVVKSRVSS"
     atgtccgagc ccatctcccg taccgaagca agacaaaagt ccgcagacat caaaaagaaa        60
     caagccgaga ccttggcggg actcccccca ggcagcctcc acatcagcct ctatatccgc       120
     tccgacccac ccctcccaaa cgacttccac tgggccttct acctccacaa cggcaccagc       180
     tccacacctg gaggaaccaa gtatcatgca cgaggcgtcg gcggcgggtg gattgccggg       240
     cacgaggcta cagcggggat attcacggag aatttcctat gtgtggtgat tcagatcgca       300
     acgattcctc catcggcgca cgagcgtgtg gatgagatta tgaggagtta cgatggttct       360
     cttaactcga ttccggggat tacttgtcgc gtgtggatac tcacgatctt gcgtatactc       420
     gttgacgaag ggttcgtgca ctgtgatatc ggagagttgg agaaggattg ctttgagttt       480
     gggaatgagc atagcgcaac ggctagcgct aatcagcagc ctcgtccggt cgtcaagtcg       540
     cgtgtttcat cttga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page