(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01440

AM920435.PC20G01440  Location/Qualifiers
FT   CDS_pept        complement(322753..324036)
FT                   /gene="Pc20g01440"
FT                   /locus_tag="PCH_Pc20g01440"
FT                   /note="Title: similarity to hypothetical protein PA3022
FT                   -Pseudomonas aeruginosa"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01440"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85473"
FT                   /db_xref="GOA:B6HD81"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD81"
FT                   /inference="similar to AA sequence:PIR:C83268"
FT                   /inference="protein motif:PFAM:PF03476"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /inference="protein motif:COGS:COG3217"
FT                   /protein_id="CAP85473.1"
FT                   /translation="MSNVDISHGGILPNLIIIFLLSALFLVLKTLTTLKTSNNPKGCRR
FT                   LGLPPGQSNLDDEFDPKYSQGVPSDQDDHGRPSWRVKALFSYPLKSCGAVELQVSNVVP
FT                   TGLEFDRQFVFAEYNNDEWNIRTLRNAGFNRLALIHPEIWVPDPSAPDYDADLPEIKSQ
FT                   GVMLISYPRMLPAGWSSLPIKVGMALKFLKSQQTFQVPLLPPADSKFPLVPVKIWKDKV
FT                   LAHDYGRLLPASLHAYLGSDTSKNTLTLLRASAPHSRQIFRNAPRKEDLGFQPNTAFAD
FT                   AYPIHLLSISSHRDVAARCAYAIPRLSIRRFRANVIVQGPSAFEEDHWKRLAIGGTEIH
FT                   ASCRTVRCRLPNVDPLSGDRHKAEPDRTLKSYRRIDDGDRTNACLGMQLVPAKEKFVLR
FT                   VGDSVEVLETGEHQYIKMLAPGEKVEGV"
     atgtccaatg tcgacatttc ccacgggggt attctcccga atttgatcat catattcttg        60
     ctgtctgcgc ttttccttgt tctgaaaaca ttgactacac tcaaaacatc aaacaatccc       120
     aaaggatgtc gccgcctggg acttccgcca ggccaaagca acctggacga tgagtttgac       180
     ccaaagtaca gtcagggtgt accaagcgat caagacgatc atggccgccc atcctggcgg       240
     gtaaaagcac tattcagtta cccgctcaaa tcctgtggtg cggttgagct gcaagtgtcg       300
     aacgtcgtac caaccgggct tgagtttgat agacaattcg tcttcgcaga gtacaacaac       360
     gatgaatgga atattcgcac cctgcgtaat gcaggcttca atcgcctagc cttgatccat       420
     cccgagatct gggttcccga cccgtctgcc ccggattatg acgcagacct gccagaaatc       480
     aagtcgcagg gtgtgatgct gatatcgtat ccacggatgc tgccagcagg atggagtagt       540
     ctacccatca aggtcggcat ggcactcaag ttcctcaaaa gccagcagac cttccaagtc       600
     ccgctgcttc cacccgcgga ctccaagttc ccactggtcc cagtcaagat atggaaagac       660
     aaagttctag cccatgacta cggtagactg ctcccagcat cactacacgc atatttaggg       720
     tccgacacat caaagaacac cctgactctc ctccgcgcca gtgcacccca ctcgcggcag       780
     atcttccgta acgcaccgcg caaagaagac ctaggcttcc agccaaacac agcctttgca       840
     gacgcgtatc caattcatct gctcagcatc tccagtcacc gggacgtagc agcacgctgc       900
     gcctatgcaa tcccacgact gagtatccgc cgcttccgcg cgaacgtcat cgtccaaggc       960
     ccgtctgctt ttgaggaaga tcactggaag cggcttgcta ttggtggcac ggagatccac      1020
     gcttcttgtc ggactgtccg gtgccgactg cctaatgttg atcctctttc tggggataga      1080
     cataaggctg agccagatcg gacgttgaaa tcgtatcgca ggattgatga tggggataga      1140
     actaatgcgt gtctggggat gcagcttgtt cctgcaaagg agaagtttgt actgagggtt      1200
     ggggattccg ttgaggtgct tgagaccggg gagcaccagt atattaagat gttggctcct      1260
     ggggagaaag tcgagggggt gtag                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page