(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01500

AM920435.PC20G01500  Location/Qualifiers
FT   CDS_pept        complement(join(331607..332321,332390..332691))
FT                   /gene="Pc20g01500"
FT                   /locus_tag="PCH_Pc20g01500"
FT                   /note="unknown EC_number=4.1.1.46"
FT                   /note="Title: strong similarity to 2,3-dihydroxybenzoic
FT                   acid decarboxylase dhbD - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01500"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85479"
FT                   /db_xref="GOA:B6HDF7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDF7"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /inference="protein motif:COGS:COG2159"
FT                   /inference="protein motif:COGS:COG3618"
FT                   /protein_id="CAP85479.1"
FT                   /translation="MLGKIALEEAFALPRFREKTKWWAGMFATDTEKHTAEINDVGPIR
FT                   LDFAERHGVGLQILSYTAPGVQDIWDAKDAQALAVEINDYIAEKVKAHPDRFAAFATLS
FT                   MHDPQEAAAELRRCVTQHGFLGALVNDTQRAGADGDDMIFYDNEKWDVFWATCTELDVP
FT                   LYLHPRNPTGTIYDKLWADRKWLIGPPLSFAQGVSLHVLGMVTNGVFDRNPKLQVILGH
FT                   LGEHIPFDMWRINHWFEDRKKMLGLGETCKRTIREYFAENLWITTSGHFSTTTLNFCMA
FT                   EVGADRILFSIDYPFETFADACDWFDSAEMSNTDRLKIGRENAKKLFKLGAYKDSTA"
     atgctcggca aaatcgccct cgaagaagcc tttgcgctcc cccgattccg cgaaaagaca        60
     aaatggtggg ctggcatgtt cgcaaccgac actgagaagc acacagcaga gatcaacgat       120
     gtcggaccaa tccgactcga cttcgccgaa cgccacggcg tcggtctcca gatcctcagc       180
     tacacagcac ccggtgtaca ggacatctgg gacgcaaagg atgcgcaagc gctcgccgtt       240
     gagatcaacg attacatcgc ggagaaagtg aaagcgcacc ccgatcggtt tgcggcattt       300
     gcgacgctct ccatgcacga cccacaagaa gcagcggccg agctgcgtcg ctgcgtgaca       360
     cagcacgggt tcctaggagc actagtgaac gacacacagc gcgccggcgc cgacggcgac       420
     gacatgatct tctacgataa cgagaaatgg gacgtattct gggctacatg cacagagttg       480
     gatgtaccgc tgtacctgca cccacgcaac ccgacaggca cgatctacga taagctctgg       540
     gcagatcgga aatggctgat tggccccccg ctgtcatttg cgcagggagt cagtctacat       600
     gttcttggca tggtgacgaa cggggtattc gatcggaacc cgaagctaca ggttatcctg       660
     ggccatctgg gggagcatat tccgtttgat atgtggcgga ttaaccactg gtttgaagat       720
     cggaagaaga tgcttggact tggggagacg tgtaagcgga cgattcggga gtactttgcg       780
     gagaacttgt ggattactac gtcggggcat ttctcgacta ctacgctgaa cttttgtatg       840
     gcggaggttg gggctgatcg aattttgttc tcgatcgatt atccgtttga gacatttgcg       900
     gatgcgtgtg actggtttga ttcggcggag atgtccaata ccgatcggtt gaagattgga       960
     agggagaatg cgaagaagtt gtttaagctt ggggcttata aggatagtac ggcttga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page