(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01660

AM920435.PC20G01660  Location/Qualifiers
FT   CDS_pept        join(373867..374132,374249..374369,374424..375506)
FT                   /gene="Pc20g01660"
FT                   /locus_tag="PCH_Pc20g01660"
FT                   /note="unknown EC_number=2.7.6.1"
FT                   /note="Title: strong similarity to ribose-phosphate
FT                   pyrophosphokinase Prps1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85495"
FT                   /db_xref="GOA:B6HDQ1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ1"
FT                   /inference="similar to AA sequence:PIR:S30558"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /inference="protein motif:COGS:COG0462"
FT                   /protein_id="CAP85495.1"
FT                   /translation="MRGVQIFSGNSHPGLADTICERLGTVPAKANLGKFANGETSVNIG
FT                   TSVRNQDVYIIQSGSEKINDSVMELLIMISACKGGSAKSITGMLYFPYSRQSKKKSHRG
FT                   AITARMLANLLTIAGVDHVITMDLHASQMQGFFGKPVDNLFAEPFIARWIRMNVPGWKD
FT                   AVVVSKNAGGTKRVTSLADTLKLNFGIVTTDRRRPKVPVATMTDSTVFFDAVDEDPIPT
FT                   EDAQPFELRMQGYNRTTATPPIPEEQEPITPPPARYLLRPETPPAARRPSELEAAYEYT
FT                   DVRVRDVITGRLVQGQLVDDDYRANEDSQSGGTTPGAGSSSHDNTETIPDAMVNSIVSN
FT                   ASSQPDHALGGSFDAVESDDEASVCAGQVDERTITLVGEVRDRSVFLVDDMIDKSGSWI
FT                   AAAETVVKRGGASKVYCIATHGLFGENSLDQMEACPSIDHIVVTNTFPISPSMLRRSKK
FT                   LIVIDVSSLLAESMRRHHYGERFVFTDPGVV"
     atgcggggcg tccagatatt ctcggggaat tcccaccccg gcctcgcaga tactatctgc        60
     gagcgtttag gcactgtgcc tgctaaagct aacctaggaa aatttgccaa tggcgagacc       120
     agtgtcaaca tcggtacctc agtccgaaac caggatgttt acatcattca aagtggcagc       180
     gagaagatta acgatagtgt tatggagctc ctgatcatga tctcggcgtg caaaggtggt       240
     tcagcgaagt ccatcacagg tatgttatat ttcccatact cgcgccaatc taagaagaag       300
     agtcatcgtg gtgccattac ggcccgcatg ctcgccaatc tcctcacgat cgccggcgtg       360
     gaccatgtga tcactatgga cctgcacgca tcccagatgc aaggattctt cggaaagccg       420
     gtcgacaacc tctttgccga accgttcatt gcccggtgga tccggatgaa tgttcccgga       480
     tggaaagacg ccgtggtggt tagcaagaac gctggcggaa ccaaacgagt gacgtcgctg       540
     gctgatactt tgaaactcaa cttcggtatc gtgacgactg atcgtcggcg cccgaaggtc       600
     cctgtggcca ctatgactga tagcacagtc ttctttgatg ctgtggatga agatcccatc       660
     ccgaccgagg atgcacagcc ttttgagctt cgtatgcaag gttataacag aactaccgca       720
     acaccaccca ttccggaaga gcaggagcca atcactcccc ctcctgcacg gtatctcctg       780
     cgcccggaaa ccccgcctgc ggctcgccgc ccatcggagc tggaagcagc ctacgagtac       840
     acggacgtgc gtgtgcggga tgtgatcacc ggtcgcctag tccaaggtca attggtggat       900
     gatgattatc gtgccaacga agattcacag tctggcggta ccacaccggg agctggcagc       960
     agcagccatg acaacaccga gactattccc gatgctatgg ttaactccat agtctccaac      1020
     gcctcatcgc agccagatca tgcgctcgga ggctcatttg acgcagttga gtccgacgac      1080
     gaagccagtg tctgtgcggg ccaggtcgac gagaggacca tcacgctggt gggtgaggtg      1140
     cgcgaccgat ctgtcttcct tgtcgatgat atgattgaca agagcggatc gtggatcgcc      1200
     gctgctgaga ccgtcgtcaa gcgtggtggg gccagcaagg tttactgtat tgccacccat      1260
     ggattgttcg gcgagaactc cttggatcag atggaagctt gtccctccat cgaccacatt      1320
     gtcgtgacca acactttccc gatctcaccg tcgatgttgc ggagatctaa aaagttgatt      1380
     gtcattgacg tatcgagtct attggcagag agcatgcgga ggcaccatta tggcgaaagg      1440
     tttgttttca ccgaccctgg tgtcgtgtga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page