(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01680

AM920435.PC20G01680  Location/Qualifiers
FT   CDS_pept        complement(join(379634..379648,379701..380249,
FT                   380328..380788,380849..381109,381156..381777,
FT                   381837..381989,382046..382446,382509..382569))
FT                   /gene="Pc20g01680"
FT                   /locus_tag="PCH_Pc20g01680"
FT                   /note="unknown EC_number=3.1.4.4"
FT                   /note="Title: similarity to phospholipase Pld1
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85497"
FT                   /db_xref="GOA:B6HDQ3"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR016555"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ3"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /inference="protein motif:COGS:COG1502"
FT                   /protein_id="CAP85497.1"
FT                   /translation="MHKFREKFEQGIDHLEESFKDAHIHDVKAEATHLKAKVGKFFNII
FT                   NPNHRHDEEHEQETDRKRSEIADSHRFKSFAPVHDGNRVKWYVDGKDYMWAVSEALEKA
FT                   TETIYIADWWLSPELFLRRPPVENQQWRLDQVLKRRAEAGVKIYIIVYKEVNQALTCNS
FT                   AHTKHALRNLCPEGTPGYGNIRVMRHPDHNIFENAADMTLYWAHHEKFIVIDYNVGFIG
FT                   GIDLCFGRWDANQHPLADVHPRGLRDDIFPGQDFNNNRIMDFQSVEDWQSNEVSKIDFG
FT                   RMPWHDVAMGLQGDCVYDIAEHFVLRWNFIKRDKYKRSHDVDWLLMEGRTGEEEDIIAV
FT                   QRPKYPCGDYVQHPLTPLSSKPRGNVGTVRAQIVRSSDDWSSGILNEHSIQNAYCETIR
FT                   NAQHYVYIENQFFITATGDQQRPIFNTIGRAIVDACVRAGKEGRKFRVIIVIPAIPGFA
FT                   GDLRDNAALGTRAIMDYQYKSICRGEHSIFGQIEKEGIDPREHVFVFALRAYDRINKTP
FT                   VLEDLEKQADVTYQDIQRGIAETIMSESVHPAVGKDGDDNEKDYAADQSAKEETLRKLQ
FT                   KFQEKVDQRKAGDGFNSKDSVAHCTMLNGGKVSEESWEGDAEAEKANFVQEELYVHGKV
FT                   CIVDDRTIICGSANINDRSQLGSHDSELAIVMEDQDLIDSKMNGQPYRASRLAATLRRQ
FT                   LWREHLGLLRAQDYDASGDPNAQPPDVSLNKIDEGPENEFVMDPLSDGVWNTWTSQATG
FT                   NTETYRMLFRADPDDHIKTFEDYDNFRPRGTRKEGHLFDPYMPAKDVREKLDLIKGHLV
FT                   WLPLDFLRDAEMAEPGLAVNQITESIYT"
     atgcacaaat tcagggagaa gtttgaacaa ggaattgatc atctggagga gtcattcaaa        60
     gacgcccata tccacgatgt caaagccgaa gctacacatc taaaggccaa agttggcaag       120
     ttctttaata tcataaaccc gaaccaccgt cacgacgagg agcacgaaca ggagacagac       180
     cgcaagcgct ccgagatcgc agactcacac cgcttcaagt cttttgcacc cgtccacgac       240
     ggtaatcgcg tcaagtggta tgtcgatggt aaggactaca tgtgggcagt ctccgaggct       300
     ttggagaaag ccaccgagac aatctacatc gccgactggt ggctctctcc agaactcttc       360
     ttgcgccgtc ctcctgtcga gaaccagcaa tggcgattgg atcaggtctt gaagcggcgc       420
     gcggaagcgg gtgtcaagat ttatatcatt gtctacaagg aggtcaacca agccctgact       480
     tgtaattccg cgcacactaa gcatgccttg cggaatctct gccccgaggg aactcccggc       540
     tacggcaata tccgagttat gcgccacccc gaccacaata tcttcgagaa cgcagctgat       600
     atgactctct actgggctca ccacgagaaa ttcatcgtca ttgattacaa tgtgggcttc       660
     atcggaggta ttgacctttg tttcggacga tgggatgcaa accagcaccc actggccgat       720
     gtccacccaa ggggtttgcg ggatgacatt ttcccgggac aagacttcaa caacaaccgg       780
     atcatggact tccagagcgt agaggactgg cagagcaatg aagtcagcaa aatcgacttc       840
     ggccgcatgc cctggcacga cgtcgctatg ggcttgcagg gcgactgtgt gtatgacatc       900
     gccgaacact ttgttctgcg ctggaacttc atcaagcgcg acaaatacaa gcgcagccac       960
     gatgttgatt ggctgctaat ggagggccgc acaggcgaag aagaagatat catcgccgtg      1020
     cagcgaccca agtacccttg cggagactat gtccaacacc cgctgacacc cctatcgtca      1080
     aagcctcgtg gtaatgtggg cactgtgcgt gctcagatcg tacgcagcag tgacgactgg      1140
     agcagcggca ttctgaacga gcatagtatc cagaacgcgt actgcgagac catccgcaat      1200
     gcccaacact atgtgtatat cgagaaccag ttcttcatta ctgccactgg cgaccaacag      1260
     cgtccaattt tcaacacgat cggccgagcg atcgtcgacg cttgcgtgcg cgcaggcaag      1320
     gaaggccgca agttccgggt gattattgtc atccccgcga ttcctggatt cgctggcgat      1380
     ctgcgcgaca atgctgcatt gggtactcgg gcgatcatgg actaccagta caagtcgatc      1440
     tgtcgcggcg agcactcgat ctttggacag atcgagaaag agggtattga cccaagggaa      1500
     cacgtgttcg tgttcgccct acgggcttat gatcgaatca acaagacgcc cgttctcgag      1560
     gacctcgaga agcaagccga tgtcacatac caggatattc agcgcggtat cgccgagacc      1620
     atcatgagtg aaagtgtgca cccagcggta ggaaaagatg gcgatgataa cgagaaggac      1680
     tacgccgccg accaaagcgc gaaggaagaa actctgcgca agctccagaa attccaagag      1740
     aaggtcgatc agagaaaggc cggtgatggt ttcaacagca aggattccgt agcgcattgc      1800
     accatgttga acgggggtaa ggtgtccgag gagagctggg agggcgacgc agaggccgaa      1860
     aaggccaact tcgtccagga ggagctgtac gtgcacggca aagtgtgtat cgtcgacgat      1920
     cgcacaatca tttgcggcag tgccaacatc aatgatcggt cccagcttgg gtcacacgac      1980
     agcgaactgg ccatcgtaat ggaagatcaa gacctaatcg acagcaagat gaacggacag      2040
     ccgtaccggg catcccgatt ggccgcaacg ctccggcgac agctatggcg cgaacacctg      2100
     ggtctactac gggcgcaaga ctacgacgcc tcgggtgacc cgaacgcgca gccgccggat      2160
     gtgtctctca acaagatcga tgaagggcca gagaacgaat tcgtgatgga tccgctcagc      2220
     gatggggtct ggaacacctg gacatcgcaa gcgaccggga acaccgagac gtatcggatg      2280
     ttgttccggg cggaccctga cgatcatatc aaaacctttg aggactatga caatttccgg      2340
     ccgcggggca cgcgtaagga aggacatctg ttcgatccgt atatgccggc caaggatgtg      2400
     cgagagaagc tggatcttat caagggtcac cttgtttggt tgcccttgga tttcctgcgg      2460
     gacgctgaaa tggcggagcc tgggttggca gtgaatcaga ttaccgagag tatctacacc      2520
     tag                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page