(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01710

AM920435.PC20G01710  Location/Qualifiers
FT   CDS_pept        complement(join(388623..390954,391090..391409))
FT                   /gene="Pc20g01710"
FT                   /locus_tag="PCH_Pc20g01710"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig31_part_ii.tfa_3670wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01710"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85500"
FT                   /db_xref="GOA:B6HDQ6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ6"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /inference="protein motif:COGS:COG3119"
FT                   /inference="protein motif:COGS:COG1368"
FT                   /protein_id="CAP85500.1"
FT                   /translation="MKVVHAVHAYLSHGIRRVRLSPGETLDAIWDFSRRYFFTLAFLSL
FT                   FSAKILHLYAHIYSLPLPRLFLWGLTFFFQDVMILLLFRILAQKVAWRPGAALLAILVI
FT                   PSSLLVSFMAAANTSFYVFTGAEIHWRQAKSFNGDAAAIHTLLTGLTGFLIVEGILLTL
FT                   SLFAAHSIHAITGGILHVWAWPVRWLFARVRPHVEPLVRRFWPSKSPDLPDPRIYEQID
FT                   MEDNDSDNEEGDHLLNTGAQLPNRLPESKRVTDGVPQRALILGLFSLFLFLRFMRPWDQ
FT                   VYMYMSTTLPLTTVIEGAERHSPVVTTGTPGLFEYLDGVTALGPAPRWSWMSKEPIAGF
FT                   DDWDQSDPLALHYNPHEDPLHISNLNKPVLEEIHNALASGDVKIKHVVFLKLESARADI
FT                   FPLQKDSFMYKRIAETWKDKTIPPEVVDRLANLTRTAEYLTNFPNGFEHDDARFNGRKA
FT                   YGGISAKNAITSATYTLKSLTGSFCGVTPLVADFNREFDHHIYQPCLPHVFDMLSQQSD
FT                   ITNDTDDFTKWPWHSTFMMSVTEMYDNQDKLTPQLGFRDKQTKETIIKPEAKHYPVTSP
FT                   EVNYYGYPESELREYIRDAIDDAERDHQRLFLSHLTSTTHHPWGVPNDAYEDLMGSKSG
FT                   ANNDMNRYLNSVGYVDDWLSDLIDILEEKGVANETLFVMAGDHGLSLPNDGGITPYDNP
FT                   HIGSFKVPIVIAHPQLPPVQIDTPVINTQIVPTIIDLLIESASLSKDSTTAARDIRSLY
FT                   EGQSLIRPQVVQQDGRESWHFTVMNTGGSWLSVRSAARPEFRLVIPLVNDVEWRFSDVS
FT                   KDPNELNPIERFSLADLAAAVNKEYDDEEILNWLYNAAYVTNWWVTENWDRWRFSPKAT
FT                   EEAKEEVKEDKT"
     atgaaagtcg ttcacgctgt tcatgcttat ttaagccacg gcatccggcg tgttcgtctc        60
     tctcctggtg agaccctgga tgccatctgg gacttttccc gtcgttattt tttcaccctc       120
     gcctttcttt cgttattcag cgccaaaata cttcatcttt acgctcatat atattctcta       180
     cctcttcccc gtctatttct atggggtctt accttctttt tccaagatgt gatgattcta       240
     ttgctgtttc gcatcctcgc ccagaaggtc gcgtggcgac cgggtgccgc cctactggca       300
     atcttggtga tcccctctag tctccttgtc tcctttatgg ctgccgccaa tacctccttc       360
     tacgttttca ccggtgccga gatccactgg cgccaagcca agtccttcaa cggtgatgcc       420
     gctgccattc ataccctgct cactggtttg accgggtttt tgattgtcga gggcatcctt       480
     ctaactctct cattgttcgc tgcccattcc attcatgcaa ttactggagg tatcctgcac       540
     gtctgggcct ggcccgttcg atggctgttt gctcgtgtgc gaccgcacgt ggagcccctg       600
     gtgcgacgct tctggccatc caaatcccca gaccttcccg accctcgaat ctacgaacaa       660
     atcgacatgg aggacaatga tagtgataat gaagaagggg atcatctgtt gaataccgga       720
     gcgcaactac ccaaccgcct cccggagtcc aagcgagtca ccgacggtgt gccccaacgg       780
     gcgctcatcc tgggattgtt cagtctcttc ctcttcctcc gatttatgcg accgtgggac       840
     caggtgtata tgtacatgtc caccacctta cccttgacca cggtcatcga gggcgcggag       900
     cgtcactccc ccgtcgtcac cactggcacg ccgggacttt tcgagtactt ggatggggtc       960
     actgcactgg gccctgcacc ccgttggagc tggatgtcaa aggaacccat cgccggtttc      1020
     gacgactggg accagtccga ccccttggcc cttcactaca acccgcatga ggacccattg      1080
     catatctcga acctcaacaa gccggtgctg gaggagattc ataacgcatt ggctagcggt      1140
     gatgtcaaga tcaagcatgt cgttttcttg aaactcgaga gtgcacgtgc cgatatcttc      1200
     cccttgcaaa aggacagttt catgtacaag cgcatcgcgg aaacgtggaa ggacaagacg      1260
     atccccccag aggttgtaga ccgccttgca aatctcaccc ggactgccga gtatctgacc      1320
     aacttcccca atgggtttga gcacgacgat gcacgtttca acggccgcaa agcgtatggt      1380
     ggcatcagcg ccaagaatgc catcacttcc gccacatata ctctcaagag tttgacggga      1440
     agtttctgtg gtgtgacccc actggtcgcc gatttcaacc gcgaattcga ccaccatatt      1500
     taccagccat gtctgcccca tgtcttcgac atgctcagcc agcaatcaga tatcaccaac      1560
     gataccgacg acttcaccaa gtggccgtgg cattcgacct tcatgatgtc tgtcaccgaa      1620
     atgtacgaca accaggacaa attgactccc caattgggat tccgtgacaa acagaccaag      1680
     gagacaatca tcaagcccga ggccaagcat tatcctgtca caagtcccga agtgaactat      1740
     tatggctatc cggaatctga gctccgcgag tacatccgtg atgccattga tgatgcggaa      1800
     cgtgaccacc agcgtctctt cctctcccac ctcacgagta ccactcacca tccgtggggt      1860
     gttccgaatg acgcctatga agacctgatg ggctcaaaat ccggtgccaa caacgacatg      1920
     aaccgatacc tgaactcggt tggctatgtg gatgattggc tctcggacct catcgatatc      1980
     ctggaggaga agggagttgc caatgagacc ttgttcgtca tggcgggaga tcacggcctg      2040
     tccctcccca acgacggcgg tatcaccccc tatgacaacc cccacatcgg cagcttcaag      2100
     gtccccatcg tgattgcaca ccctcaactc ccacccgtcc agatcgacac tccagtcatc      2160
     aatacccaga tcgtccccac catcatcgac ttgttgatcg agtcggcatc cctcagcaag      2220
     gacagcacaa ctgccgcccg cgatattcgc tcgctgtacg aaggtcaatc cctgatccga      2280
     ccgcaggtcg tccagcagga cggacgcgaa tcctggcatt tcacagtcat gaacactggt      2340
     ggttcatggc tatctgttcg gtcggccgcc cggcctgagt tccgcctggt gatcccgcta      2400
     gtcaacgacg tggaatggcg tttctccgat gtctccaagg acccgaacga gctgaacccc      2460
     atcgagcgct tcagccttgc cgatctagcg gccgcggtca ataaggagta tgacgatgaa      2520
     gaaattctca actggctcta caacgcagcc tatgtcacca actggtgggt aacggagaac      2580
     tgggatcgat ggagattctc cccaaaggcc acggaagagg ccaaggaaga ggtcaaggaa      2640
     gacaagacct aa                                                          2652
//

If you have problems or comments...

PBIL Back to PBIL home page