(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01720

AM920435.PC20G01720  Location/Qualifiers
FT   CDS_pept        391965..393164
FT                   /gene="Pc20g01720"
FT                   /locus_tag="PCH_Pc20g01720"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1492_0.tfa_2510cg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01720"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85501"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ7"
FT                   /protein_id="CAP85501.1"
FT                   /translation="MLGSLFGWVSLLFEPLAFQVPLIEPQPRLKSENGIAIPVQGPWQD
FT                   IITGHYAVPPVLKIHDRNSVVKWSWQREDVTQPLPPLIRSGLYSGYNDATDMKWMRGGR
FT                   SVAAVYSALVVVINHTPDQPSTDKKITFAINRANDVLHNAHTIEPLPGDRLAVGTTGQR
FT                   PWDGILVYNMSEALPLMDEPPVLQRIEGLRAIHALIWDEQGQMLWATGTDAAADGSDPV
FT                   PAYGVIQGYPFDAETGLLSIDEAYRFKFPEYFDIDAEWGHGYSWWAGPHDLVPVPNERV
FT                   LLVSNDIGLHAFDINEMNFTAEYDEVVEKYMPGFEVTTNDRHGINRQGEYVELPQSDLK
FT                   GFSLAPDGSFLYTQSLWRLFRGNYTSLVVDGVRHQIMKGNEIYRSRWFGDIDGWPKPKT
FT                   "
     atgttaggga gcttattcgg ttgggtctcg ctccttttcg agccactggc ctttcaagtt        60
     cctctaatcg aacctcaacc cagactcaag tcagaaaatg gtatagctat tcccgtccag       120
     ggcccctggc aagatatcat caccggtcat tatgccgtcc ctcccgtatt gaaaattcat       180
     gaccggaaca gtgtggtcaa atggagttgg cagcgagaag atgtcactca acctctgcct       240
     cctctgattc ggagtggttt atatagtggt tacaacgatg cgaccgatat gaagtggatg       300
     cgaggcggta gaagcgtggc tgccgtctac agtgctctcg tcgtcgttat caaccacact       360
     cccgatcaac cctccaccga taagaaaatc accttcgcca tcaacagagc caatgatgtc       420
     ctacacaatg cccatactat cgaaccttta cccggtgatc gactcgccgt cggaactacc       480
     ggacagcgac cttgggatgg cattttggtc tataacatga gcgaggctct cccccttatg       540
     gacgaacctc ccgtcttgca aaggatcgaa ggtctccggg ccatccacgc cttgatctgg       600
     gatgaacagg gtcagatgtt gtgggcaacc ggcaccgatg ctgctgccga tggttccgat       660
     cccgttccgg cctacggtgt catacagggg tacccctttg atgcggagac gggcctgctc       720
     agcatcgatg aagcctatcg attcaaattc cccgagtatt tcgatatcga cgccgaatgg       780
     gggcatggtt atagctggtg ggccggtccc catgatctcg tccccgtccc taacgaacgg       840
     gtattactcg tctccaacga tatcggtctc cacgccttcg atatcaatga aatgaatttc       900
     actgccgaat acgacgaagt cgtggagaaa tatatgcccg gtttcgaggt caccaccaac       960
     gatcggcacg ggatcaaccg ccagggagaa tacgtggagt tgccgcagtc ggacctcaag      1020
     ggcttcagtc tcgcccccga tggaagcttc ctatacaccc agtctctatg gcgactattc      1080
     cgtgggaact ataccagtct tgtggtcgac ggtgtgcgtc accagatcat gaaagggaat      1140
     gaaatctatc ggtcgcgatg gttcggagac atcgatggct ggcccaaacc aaagacatag      1200
//

If you have problems or comments...

PBIL Back to PBIL home page