(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01740

AM920435.PC20G01740  Location/Qualifiers
FT   CDS_pept        complement(join(397195..397798,397968..398002))
FT                   /gene="Pc20g01740"
FT                   /locus_tag="PCH_Pc20g01740"
FT                   /note="Title: similarity to hypothetical protein
FT                   contig_1_65_scaffold_4.tfa_350cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85503"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDQ9"
FT                   /protein_id="CAP85503.1"
FT                   /translation="MPDWEVEDSHRCAPCKMNRTAFFSSSIINNGSSNRQSCISFSLRP
FT                   APWDSAKILVHPSGYPIEAPPMYSIISKDSPPNVVLLRGWGEGPWVIVGDARLPTLSSK
FT                   IHLTFYGQPIIMRLNQLSGNYALESPAVGQLKWRPDMFTGRDMQLQDATGRKLAKLRPG
FT                   KSGEKLLEILVSHDSSFSEIVLLSGWTARAMTKSVTEATGEILSSVVGA"
     atgcccgatt gggaagtaga agatagtcat agatgtgctc cttgcaaaat gaaccgtacg        60
     gcattctttt cttcttccat aatcaataac gggtcttcaa atcgacagtc ctgtatctca       120
     ttctcactgc gaccagcgcc atgggactca gcaaagattc tggttcaccc ttcaggctat       180
     ccaatcgagg caccgcctat gtactcgatc atatccaagg atagccctcc aaacgtcgta       240
     ttacttcggg gctggggcga aggtccatgg gtcatcgtcg gcgacgctcg acttccaacc       300
     ctatcttcca agatacatct gaccttttac ggccaaccaa taattatgcg tttgaaccaa       360
     ctctcgggca attacgccct cgagtcaccc gccgtgggtc aattgaagtg gagacccgat       420
     atgttcacag ggagggacat gcagttgcag gatgctactg gtagaaagct agccaagcta       480
     cgaccaggga aatcgggtga gaagctcttg gagattctcg tctctcatga cagttctttc       540
     tctgagatag tgttgctatc aggatggact gccagggcta tgaccaagtc ggtgacagag       600
     gcgacagggg agattctgag ctctgtggta ggggcttag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page