(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01840

AM920435.PC20G01840  Location/Qualifiers
FT   CDS_pept        complement(join(420597..420915,420974..421326,
FT                   421396..421734))
FT                   /gene="Pc20g01840"
FT                   /locus_tag="PCH_Pc20g01840"
FT                   /note="unknown EC_number=2.5.1.1"
FT                   /note="unknown EC_number=2.5.1.10"
FT                   /note="unknown EC_number=2.5.1.29"
FT                   /note="Title: similarity to geranylgeranyl pyrophosphate
FT                   synthase GGPPS - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01840"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85513"
FT                   /db_xref="GOA:B6HE17"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE17"
FT                   /inference="similar to AA sequence:TREMBL:AB016043.1"
FT                   /inference="protein motif:COGS:COG0142"
FT                   /protein_id="CAP85513.1"
FT                   /translation="MSLFGSVFGFFLRGASPILGMVAVSSFLYLIVDHIHIPRWWDKKT
FT                   HLIGRKSPERITRHECPYDYLREIYGKHHWKAFVHKLSPALHNDDPAKYSMVLEIMDAI
FT                   HLCLMLVDDISDGSDYRKGRPAAHSIYGPSETGNRAYYRVTQILNKTTKDFPNLAPWLM
FT                   QDLQDILEGQDISLIWRRDGLSAFPIATAERLAAYRRMASLKTGSLFRLLGHIVLENDS
FT                   MDETLTTVAWHSQLQNDCKNVYSSEYAKLKGSVAEDLHNREMTYPIVLALDAPDGHLVT
FT                   GALEYPSPRNIRNAMRVIRGDYVRSICTNELRKSGASVKEWLELWGRKEKLDLKA"
     atgagcctct ttggaagtgt gttcggattc tttcttaggg gggctagccc tatcctgggt        60
     atggttgctg tgagcagctt cctttatctg attgttgacc atattcacat cccccgatgg       120
     tgggacaaaa agacccacct gatcggacga aaaagtcccg agagaatcac taggcatgaa       180
     tgcccttatg attatctgcg agaaatctac ggcaagcatc attggaaagc ttttgtccac       240
     aagctatccc cagcccttca taatgatgac cctgctaagt actccatggt gctggagatt       300
     atggatgcta tacacctttg cttaatgttg gttgacgata tttccgacgg aagcgactat       360
     cgcaaaggac gacccgctgc tcacagcata tacggcccat cagaaacagg aaaccgcgcg       420
     tattacagag tcacccagat cctcaacaaa accaccaagg acttccccaa cctcgcgcca       480
     tggttaatgc aggatctcca ggatatcctc gaaggccaag atatatccct catttggcgc       540
     agggatggac tcagcgcctt ccctatcgct accgcagaga ggcttgcagc atatcgaaga       600
     atggcctctc tcaagaccgg ttccttattc cgtttactag gtcacattgt cctagagaat       660
     gattctatgg atgaaacgtt gaccacagtc gcttggcatt cgcagctgca aaacgattgc       720
     aagaatgttt attcttcgga gtatgcaaag ctgaagggct ctgtggctga agacttgcac       780
     aatcgcgaga tgacctaccc catcgtgcta gcattagatg cacctgacgg ccatttggtg       840
     acgggggctc tagaatatcc gtcgcctcgc aatatccgta atgccatgag ggtaattcga       900
     ggtgactatg tgcggagcat atgcacgaat gagctgcgta aatcaggtgc ctcggttaaa       960
     gaatggctgg aactatgggg cagaaaggag aaacttgatt tgaaggcgtg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page