(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01850

AM920435.PC20G01850  Location/Qualifiers
FT   CDS_pept        join(422801..423102,423169..423370,423453..424328)
FT                   /gene="Pc20g01850"
FT                   /locus_tag="PCH_Pc20g01850"
FT                   /note="unknown EC_number=1.-.-.-"
FT                   /note="Title: strong similarity to hypothetical
FT                   monooxygenase paxM - Penicillium paxilli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01850"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85514"
FT                   /db_xref="GOA:B6HE18"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE18"
FT                   /inference="similar to AA sequence:TREMBL:AF279808.5"
FT                   /inference="protein motif:PFAM:PF01360"
FT                   /inference="protein motif:COGS:COG0654"
FT                   /inference="protein motif:COGS:COG0644"
FT                   /protein_id="CAP85514.1"
FT                   /translation="MTKMSKSEFQVIIVGGSIGGLTLAHCLQRAGIDHIVLEKASNPAP
FT                   QIGASVGIAPNGARVLDQLRLYDLVEEQIEPLNTATIHYPDGYSFETKFTKVIHERFGY
FT                   PIAFLDRQKLLEILYQGYPDHRKISLGERVIKVEKSGDVAIVSTAKGSVYRGHLVVGAD
FT                   GVHSKHSLVRMGTEHYAGLKAEFRCLFGISSAIKALIIGDQVNAFFDGFTIITIHGKGG
FT                   RVYWFVIQKLDKEYTYPHCPRYTAGDIETAAEELRTIVFYKDINFGQLWENRETVSMTV
FT                   LEEHTFDIWHHDRLVLLGDSAHKMTPNIGQGANMAIEDAASLANLLQRLRKGLDIWPPT
FT                   NGQVKILLEQYRSIRYGRVNSVYKSSRILARLHARDGLLKTLIGRYYVPYAGDLPAYVG
FT                   SKSIADGVMCDFLPPPKRSGDGWERYRTEDSNSGWVLQAIFCVLVFAMLFTYIDWEWVG
FT                   L"
     atgaccaaga tgagtaagtc agagttccag gtcatcattg taggaggatc aatcggaggc        60
     ttgactctgg cacattgcct acaacgtgct gggatcgacc atattgtcct cgaaaaagcg       120
     agcaatccag caccccagat tggagcatcc gttggcattg caccaaacgg agcccgtgtt       180
     ctcgatcaac ttcgactgta cgatctggtc gaggaacaga ttgagcccct aaacacagca       240
     actatccact atccggacgg ttacagcttc gaaaccaagt ttaccaaggt aatacatgag       300
     aggttcggtt atccaatcgc attcctggac cgacagaagc tgcttgaaat cctctatcag       360
     ggatacccag atcatcgcaa aatttccctg ggagaaagag tgataaaggt tgagaagtcc       420
     ggtgatgtag ctatagtgag cacggctaag ggctctgtct accgaggcca cctcgtcgtc       480
     ggcgcagatg gtgttcacag caaacattct ttggttcgaa tggggactga acactacgca       540
     ggtctcaagg cagagtttcg ctgtctcttc ggcatctcct ccgccatcaa ggcgttgatt       600
     ataggagacc aagtgaatgc tttctttgat ggcttcacca tcattacgat ccatgggaag       660
     ggagggcgcg tatactggtt cgtcatacag aagttggata aggaatacac ttatccacac       720
     tgccctcgct acacggcagg cgacatcgaa actgcggcag aggaactgag aactatagta       780
     ttctacaaag atatcaattt tgggcagtta tgggagaacc gggaaacagt ctccatgacc       840
     gtcttggagg aacatacctt tgacatctgg catcatgacc ggctagttct tctgggcgac       900
     agtgctcaca agatgactcc caatattgga caaggagcca acatggcaat cgaggacgct       960
     gcatcgctgg caaacctact tcaacgctta cggaaaggct tggacatttg gcctcccacg      1020
     aatggacagg tgaagattct tttggaacaa tatcgcagta ttcgatatgg ccgcgtcaac      1080
     tcagtctaca aaagctcccg cattctggcc cgattacatg ccagagatgg cctactaaag      1140
     actcttattg gccgatacta tgtgccatat gcaggtgact tgccggcgta tgtcggatcc      1200
     aaatctattg ccgatggggt gatgtgtgat tttcttcctc cgccaaagcg cagtggagat      1260
     ggatgggaga gatatcggac cgaagactca aattcggggt gggtgcttca agctatcttt      1320
     tgtgtcctcg tctttgctat gcttttcacg tatatagact gggaatgggt tggcctgtag      1380
//

If you have problems or comments...

PBIL Back to PBIL home page