(data stored in SCRATCH zone)

EMBL: AM920435.PC20G01930

AM920435.PC20G01930  Location/Qualifiers
FT   CDS_pept        complement(join(441622..441896,442017..442061,
FT                   442139..442151))
FT                   /gene="Pc20g01930"
FT                   /locus_tag="PCH_Pc20g01930"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g01930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85522"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE26"
FT                   /protein_id="CAP85522.1"
FT                   /translation="MSTPASTYIVIPEASGAQIGHVPSVLRYPLPRGGADRVSSASQQF
FT                   TVQPLYNLPGFIFKTCWPSSLLEQILEKYRPGTMAEGNPSTLNQLVQILAQTRGIHMDV
FT                   PNGKYV"
     atgtcgaccc cggcctcaac ttatatcgtg atccctgagg cctctggggc ccaaattggt        60
     cacgtccctt cggtgttgcg gtacccgttg ccgaggggtg gtgcagaccg agtatcgtct       120
     gcatcacagc agttcactgt gcaacctttg tataaccttc ctggattcat atttaagacc       180
     tgttggcctt caagtctgtt agaacaaatc ttggaaaagt atcgaccagg aacgatggca       240
     gaaggcaacc cgtcgactct caatcaattg gttcaaattc tagcacagac tcgggggata       300
     cacatggacg tcccaaatgg taagtatgtt tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page