(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02020

AM920435.PC20G02020  Location/Qualifiers
FT   CDS_pept        458144..458902
FT                   /gene="Pc20g02020"
FT                   /locus_tag="PCH_Pc20g02020"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   mg01347.1 - Magnaporthe grisea"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85531"
FT                   /db_xref="GOA:B6HE76"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE76"
FT                   /inference="protein motif:COGS:COG2128"
FT                   /protein_id="CAP85531.1"
FT                   /translation="MSPTVKVPLRRTWLGNTYIRNWTLMYVIQRRLTIKNTFKSLGINH
FT                   TRTMRLPYAPSTPPVDAPPDTADIYARIAERRNPRPLIPLDLSLLHSPPVADGWNSFIG
FT                   AIRSRTLVDSGVMELAVCRVAVLNNAVYEWNAHAPLALKGGIKPDQLQAALTLPCTAEG
FT                   DIAGLESSALTPQQRAVLRYTDQMTRTIRVDDTVFAELKTVGYDDREIVELTTGIAGYN
FT                   CVSRFLVALDVGENNAREMKSVDEVVATLQ"
     atgtccccga ctgtcaaggt gccgttgagg agaacatggc taggtaatac atacattaga        60
     aactggactc tgatgtacgt gattcagcgt agactcacca tcaaaaatac cttcaaatca       120
     ctcggaatca atcatacacg caccatgcgt ctgccctacg ccccttccac cccgcctgtc       180
     gatgcgcccc ccgacacagc cgacatctat gctcgcatcg cggagcgcag aaacccccgt       240
     cctctgatcc cgcttgacct ctccctcctt cacagcccac ctgtcgccga tggctggaac       300
     agctttatcg gggctattcg gtcgcgaact ctagtggact ctggtgttat ggagttggca       360
     gtctgccggg tcgctgtact caataacgct gtttacgaat ggaatgctca cgccccactg       420
     gctctcaaag gtggtatcaa gcccgatcaa ttgcaggctg ctcttacact gccctgcacc       480
     gccgagggag atattgctgg gcttgagagt agcgccctca ccccgcaaca gcgcgccgtt       540
     ttacgctata ccgaccagat gactcgcacc attagagttg atgatactgt ctttgctgaa       600
     ttgaagacag tcgggtacga tgaccgcgag atcgtggagc tcaccactgg cattgccggt       660
     tataactgtg tgagccggtt cttggttgcg ctggacgtcg gcgagaacaa tgctcgcgag       720
     atgaaaagtg tggatgaggt ggtcgccact ctgcaatag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page