(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02120

AM920435.PC20G02120  Location/Qualifiers
FT   CDS_pept        join(482296..482526,482590..482667)
FT                   /gene="Pc20g02120"
FT                   /locus_tag="PCH_Pc20g02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02120"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85541"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA1"
FT                   /protein_id="CAP85541.1"
FT                   /translation="MAPHGVEGSRIRFSWHRGESEVIWLPLDATSSTPLFVKVLVGYAA
FT                   VRLVRAWSRGKKRRAIPMVVVSSTQHLRNTAQGLVEDERQISRRLGVESDVAVSLGE"
     atggctccgc acggagtaga ggggtctcgg atacgttttt cttggcatcg gggggaaagc        60
     gaagttattt ggctgccatt agacgcaaca tcgtcgacac ccttattcgt aaaggttctt       120
     gtcggatatg ctgcggttcg gctggtccgg gcctggtctc gggggaagaa aaggcgtgcc       180
     atcccaatgg tggttgtctc gtcaactcag catttgagga atacggcaca gggcttggtg       240
     gaagacgagc gacagatttc tagaaggctt ggagttgagt ctgacgtcgc tgtttcgttg       300
     ggggaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page