(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02130

AM920435.PC20G02130  Location/Qualifiers
FT   CDS_pept        complement(join(483216..483561,483640..485030))
FT                   /gene="Pc20g02130"
FT                   /locus_tag="PCH_Pc20g02130"
FT                   /note="Title: strong similarity to acetyl-coenzyme A
FT                   transporter like protein An02g13410 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02130"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85542"
FT                   /db_xref="GOA:B6HEA2"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR024371"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA2"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /inference="protein motif:COGS:COG2271"
FT                   /protein_id="CAP85542.1"
FT                   /translation="MTRKNATLSKRRSKANLTVATGSNGRANGKMNNNIEMRRRDTPSS
FT                   ETSAERTAQLMSRTSFSLDNEPIVPQTPVQTNTTFHNLPRSDRRNFLLLVLLYFLQGIP
FT                   MGLATGSVPFLLKPYLSYGQIGIFSLASYPYSLKLFWSPIVDAVWSTRFGRRKSWITPV
FT                   QVIAGLAMIYMGGHIEEMMVQAGADGGAGVWKFTYWWFMLVLFCATQDIAVDGWAITLM
FT                   SPPNISYASTAQTVGLTAGHFLSYTVFLAFNSKDFANRWFRTIPGDGGLLSLGTYLNFW
FT                   GWAYLIVTCGLAFLKKEERTKERDSIMDVYKSMWSVLKLKNIQTIIVIHLIAKIGFQAN
FT                   DGVTSLKLLDKGFGQDNMALVVLIDFPFEIMLGYYAGQWSTNYGAMRLWGWAFVGRLAA
FT                   AVLAQLTVMIYPTASEVPMWYMLTVIGEHVLSTFMNTVMFVSISAFHARIADPAIGGTY
FT                   MTLLATVSNLGGTFPRIFVLKLVDMFTQATCLPPTIPPPADSLKDTLIMTPFSCALEPE
FT                   KNRCINGGGTCHIDRDGYYMTNILCVLIGALTFIMFIKPAAQKLQDLPLRAWRLASNPQ
FT                   RG"
     atgacacgca agaacgcgac cctctcgaag cgccgctcca aagcgaacct gacagttgct        60
     accgggtcaa acgggcgtgc gaatggcaag atgaataaca acatcgaaat gcgcaggagg       120
     gatacgccct cctcggaaac ctcagccgaa agaacagccc aacttatgtc acgaacaagc       180
     ttctccctcg acaatgagcc gatcgtaccc caaaccccag tccagacgaa tacaactttc       240
     cacaacctac cacgcagtga tcgacgtaac ttcctgctgc tggtcttgct atactttctc       300
     caaggaattc ccatgggcct agccaccggc tctgtaccct tcctgctcaa gccgtacctc       360
     tcatacggcc agattggaat cttctcgctc gcctcatacc cgtactcgct caaattgttt       420
     tggagtccca ttgtcgacgc tgtgtggagt acgcgctttg gtcggcgcaa gagctggatt       480
     acccccgtgc aggtgattgc cggactggct atgatttata tgggcggcca tatcgaggag       540
     atgatggtcc aggccggagc cgatggtggt gcgggtgtct ggaaattcac atactggtgg       600
     ttcatgttgg tgcttttctg cgccacccag gatattgctg tggatggatg ggctatcact       660
     ttgatgtccc cgcctaacat ctcctacgct tcaaccgccc aaacggtcgg attgacagcc       720
     ggccacttcc tgtcctacac tgtcttcttg gctttcaact cgaaggactt tgccaacaga       780
     tggttccgaa ccatccccgg agatggcggt ctgctatcgc tcggcactta tctcaacttc       840
     tggggctggg cttatctgat cgtgacttgc ggtttggctt tcctcaaaaa ggaagaacgc       900
     accaaggaac gtgacagcat tatggatgtg tataaaagta tgtggagcgt tctgaagtta       960
     aagaacatcc agaccatcat tgtgattcac ctgattgcca agatcggctt ccaggccaat      1020
     gacggagtca ccagtctcaa gctcctggac aagggctttg gccaagacaa catggccctg      1080
     gtcgtgttga ttgacttccc ctttgagatc atgctgggct actatgccgg ccaatggtca      1140
     accaactacg gagcaatgcg tctctggggc tgggcctttg tcggacgatt ggcagccgct      1200
     gtgctcgccc aattgaccgt tatgatttac cccacggcct cggaagtgcc aatgtggtat      1260
     atgctcacgg taatcggcga gcatgtcctc tcaaccttta tgaatactgt catgttcgtc      1320
     tccatctcgg ccttccacgc ccgcatcgcc gatccagcca ttggcgggac gtacatgact      1380
     ctccttgcca ccgtctccaa cctgggagga acattccccc gcatctttgt ccttaaactc      1440
     gttgacatgt tcacccaagc gacttgtctt cctccaacca tccccccacc tgccgactcc      1500
     ctcaaggaca ccctcatcat gacgccattc tcctgcgccc tcgagccgga gaagaaccgc      1560
     tgcatcaacg gcggcggtac ctgtcacatc gaccgtgacg ggtactatat gaccaacatc      1620
     ctctgtgtgc tcattggcgc gctcacattc attatgttta tcaagccggc tgcgcagaag      1680
     ctacaggact tgcctctccg cgcttggcga ttggcatcca acccccaacg gggttga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page