(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02140

AM920435.PC20G02140  Location/Qualifiers
FT   CDS_pept        join(485838..485916,485973..486910)
FT                   /gene="Pc20g02140"
FT                   /locus_tag="PCH_Pc20g02140"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An02g13420 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02140"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85543"
FT                   /db_xref="GOA:B6HEA3"
FT                   /db_xref="InterPro:IPR018464"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEA3"
FT                   /protein_id="CAP85543.1"
FT                   /translation="MASHAPASPDPEEEELDSEIASIRAEIRKLQKHKRILTSSLLTTD
FT                   PVQKLLRKPQPPTTNPTDPLTRIFPLVHAAGAHTSSNHHRIAFGATAFPFKDPSPAANG
FT                   VTLLGVRIDVCTRNGRFAKPYYVILQKERSRAGPGAGGADSKVLKVYRHTVPAFISIAK
FT                   LESVYLPRPGVTRDNGDGAGGGSSGEDEDTEPAKPWKKGGNSARKQDLRGFVRELRREL
FT                   VAWHMRVDAVEFLREKLGLVGEGGGPLPFDVSPDRDTGIVSLAAVAIEARYVRIEWVDG
FT                   RVGRFKLSNTGIVERAVVIGDQGRDKKVEDAITGGGGRVETVLDRLRAEVLSGSPGR"
     atggcgtctc acgcccccgc atcaccagac ccagaagaag aggaactaga ctcagagata        60
     gcctccatcc gcgcagaaat ccgaaagctt caaaaacaca agcgcatcct cacatccagc       120
     ctcctaacaa ccgacccagt ccaaaaactc ctccgcaaac ctcaaccacc caccacaaac       180
     ccaactgacc ccctcacaag aatcttcccc ctcgtccatg ctgccggcgc acacacctcc       240
     tcaaaccacc accgcattgc cttcggcgcc acagccttcc cattcaaaga cccatccccg       300
     gcagccaatg gtgtgaccct cctcggcgtg cgcatcgacg tatgcacacg gaatggccgc       360
     ttcgcaaaac catactacgt aatcctccaa aaagagcgaa gtcgcgctgg tccgggcgca       420
     ggtggtgctg actcgaaggt cttgaaggtg tatcgacaca ccgtgccggc gtttatatcc       480
     atagcaaagc tggagagtgt ttacctgcca cggcctggtg taacccgcga caatggagat       540
     ggggctgggg gaggttcatc tggcgaggac gaggacactg agcccgcgaa gccgtggaag       600
     aagggcggca actctgcccg gaaacaagat ctgcgggggt ttgtgcgcga gcttcggagg       660
     gagcttgttg cctggcacat gcgtgttgat gcggttgagt tcctgcgtga gaagttgggt       720
     ctcgttggtg agggtggggg gccgttaccg tttgatgttt cgccggatcg agacactggg       780
     attgtgtctt tggctgctgt tgcgattgag gcgcggtatg tgcggattga gtgggttgat       840
     gggcgggttg ggcggtttaa gttgtctaat actggaattg tggagcgggc tgttgttatt       900
     ggtgatcagg gtcgggataa gaaggtcgag gatgcgatta ctgggggtgg tgggagggta       960
     gagacggttt tggataggtt gagggctgag gtgttgtctg gatcacctgg gagatga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page