(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02220

AM920435.PC20G02220  Location/Qualifiers
FT   CDS_pept        join(503454..503672,503810..504092,504148..504676,
FT                   504726..505053)
FT                   /gene="Pc20g02220"
FT                   /locus_tag="PCH_Pc20g02220"
FT                   /note="unknown EC_number=2.7.1.33"
FT                   /note="Title: strong similarity to pantothenate kinase panK
FT                   - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02220"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85551"
FT                   /db_xref="GOA:B6HEB0"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB0"
FT                   /inference="similar to AA sequence:TREMBL:AF098669.1"
FT                   /inference="protein motif:PFAM:PF03630"
FT                   /inference="protein motif:COGS:COG5146"
FT                   /protein_id="CAP85551.1"
FT                   /translation="MAERVEVDTRKRPNRLEAAITNPGAVKINVTGAFIVDDEPRSKSP
FT                   VDAEGVHYENKDIRLPHHTGVVSHVAVDIGGTLAKLVYFTRELDTADNGGRLNFLNFET
FT                   HRIDLCINFIRQLKEEHEKRNGSTREGLCVVATGGGAYKYYDRLKEELNVNILREEEME
FT                   CLIIGLDFFITEIPNEVFTYSDADPEPMQYAEARADVYPYLLVNIGSGVSMIKVSGPRQ
FT                   FERVGGTHLGGGTFWGIMSLLTGSRTFDDMLAMADRGDNSAVDMLVGDIYGMDYTKIGL
FT                   KSTAIASTFGKVLRLKNDAEQGAEDGEGLIRDDPSEASESSKSSHGAKPNPEDMSRSLL
FT                   YAISNNIGQIAYLQSEKHSVKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRH
FT                   EGYLGAVGAFIRRQPQNWGRRNSVDDVVAPQAVRNLVQNNSVLQQHGRSSSDL"
     atggccgaac gtgtggaggt agatactcgc aagcgcccga accgtttgga agctgcaatc        60
     accaatcccg gcgccgtcaa aatcaatgtc acgggcgcat tcatcgtcga cgacgaacca       120
     cgatccaaaa gtcccgtcga tgcagagggc gtacactacg aaaacaagga tattcgactt       180
     ccacatcata caggcgttgt gagccatgtg gctgtcgata ttggtggaac acttgcgaag       240
     cttgtctatt tcactcgaga gctcgacact gcggataatg gcggccgact caatttcctc       300
     aactttgaaa cgcaccggat cgatctgtgc atcaacttca tccgacaact caaagaggaa       360
     cacgagaagc gcaatggttc gacacgggag ggactgtgtg tcgtggccac tgggggtggc       420
     gcatacaagt actacgatcg gttgaaagaa gagttaaatg ttaatattct acgggaagaa       480
     gagatggaat gcttgatcat tggactggac ttcttcatta ccgaaattcc caacgaagtc       540
     ttcacttata gcgatgccga tcccgaaccg atgcaatatg ccgaagcccg tgctgatgtc       600
     tacccttatc tcctcgtcaa tataggatca ggtgtgtcga tgataaaagt gtccggtccg       660
     agacaattcg agcgtgtggg cggaacacat ctcggtggtg gaacgttctg gggcatcatg       720
     tctttattga ccggctcccg gaccttcgac gacatgctag caatggccga ccgcggggac       780
     aacagtgcag tggacatgct tgtaggagat atctacggca tggattacac caagattggg       840
     ttgaaaagca cagctattgc cagtactttc ggcaaagtgc tccggttgaa aaacgatgcc       900
     gagcaagggg ccgaggacgg cgagggcttg attcgcgacg accccagtga agctagcgag       960
     tctagcaagt ccagccatgg agctaagccc aatccggaag atatgagcag gagtctgctc      1020
     tacgccatca gtaataatat tggtcagatc gcatatctgc agtctgaaaa gcattcagtc      1080
     aaacatattt acttcggagg ctcatttatt cggggccacc ggcaaacaat gaatactctc      1140
     tcctacgcca tccgcttctg gtccaagggc gagaagcaag cgtatttcct gcgccatgag      1200
     ggctacctag gtgccgtggg tgccttcatc agacgccagc cgcaaaactg gggtcgcaga      1260
     aacagtgttg acgacgtagt cgcaccgcag gcggtccgaa acctcgtcca aaataacagt      1320
     gtccttcaac aacatggcag gtcgtccagt gatctataa                             1359
//

If you have problems or comments...

PBIL Back to PBIL home page