(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02250

AM920435.PC20G02250  Location/Qualifiers
FT   CDS_pept        join(510419..510483,510558..510850,510918..511521,
FT                   511575..511938)
FT                   /gene="Pc20g02250"
FT                   /locus_tag="PCH_Pc20g02250"
FT                   /note="unknown EC_number=3.2.1.14"
FT                   /note="Title: similarity to chitinase - Chelonus sp."
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02250"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85554"
FT                   /db_xref="GOA:B6HEB3"
FT                   /db_xref="InterPro:IPR001002"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018371"
FT                   /db_xref="InterPro:IPR036861"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEB3"
FT                   /inference="similar to AA sequence:PIR:A53918"
FT                   /inference="protein motif:PFAM:PF00704"
FT                   /inference="protein motif:COGS:COG3325"
FT                   /inference="protein motif:COGS:COG3858"
FT                   /inference="protein motif:COGS:COG3469"
FT                   /protein_id="CAP85554.1"
FT                   /translation="MFKRLALGLLAAQSVAAMRFAMYHTTALPGQEKTEGIDYAIMSFA
FT                   ASKLFNSDSPAEYKPFESPETMRKRFSPDTKLMVAIGGWGDTAGFSEGAKDEASRTRYA
FT                   KNVASMLDAHGFDGVDIDWEYPGGNGQDYRQVPNEEKVDEIETYPLFLEALRKELGDKI
FT                   ISIAVPGRKQDLIAYTKEQGPKIWKSVDMVNVMSYDLTNRRDNVTNHASGVQGSLDTIN
FT                   EYLAIGADPEKLNLGFAYYAKWFTTNADSDCEENPLGCELAKLENDDGSDNGKSGALTF
FT                   EASTVAAPPKDLKDSTDGLCGFGAKTKCPSGQCCSSSGYCGTTDEFCQAGCLSDYGTCK
FT                   GISITDSWRKAQKDGKTDEKGGGQYYFDSENNLFWTWDTPEMIARKFKEIVAEKKLGGV
FT                   MAWSLGEDTYKFEHLEAMQKGIKSQSNSPKVEEPPVAERGCA"
     atgttcaaac gtctcgcact tggtctgctg gccgcccagt cagtggctgc catgcgtttt        60
     gccatgtacc atacaactgc tcttccggga caggagaaga ctgagggcat tgactatgca       120
     atcatgagtt ttgctgcctc aaagctattc aactccgact caccggcaga atacaagcca       180
     ttcgagtccc ccgagaccat gcgcaagcgc ttcagcccgg ataccaagct aatggtcgct       240
     attggtggct ggggtgatac cgctggcttc tccgagggag ccaaggacga ggcttcgcgc       300
     acgcgatatg ccaagaatgt cgcatccatg ctcgacgcac atggtttcga cggcgtcgat       360
     attgactggg aataccctgg tggcaatggc caggactaca gacaagtgcc caacgaggag       420
     aaagtggatg agatcgaaac atatcctctc ttcctggaag ctctccgcaa agaacttggc       480
     gataagatca tctctatcgc agtacctggt cgtaagcagg acttaatcgc ctataccaag       540
     gaacagggcc ccaagatctg gaagtctgtc gatatggtca atgttatgag ctacgatctg       600
     actaaccgtc gcgacaatgt taccaatcac gctagcggtg tccagggttc cttggacacc       660
     attaacgagt atctcgcgat tggggctgat cccgaaaagc tcaaccttgg ctttgcatat       720
     tacgccaagt ggtttaccac caacgctgac tccgactgtg aggagaaccc tctgggctgt       780
     gagcttgcca agcttgagaa cgacgacggg tcggacaatg gcaagtccgg tgctttgact       840
     ttcgaggcta gcactgttgc tgctccccct aaggatctga aagacagcac cgatggattg       900
     tgtggattcg gagcgaagac caagtgccca tcaggacagt gctgcagttc ctccggctat       960
     tgcggtacta ccgatgagtt ctgccaggct ggctgtctct ctgactacgg tacctgcaag      1020
     ggtatctcta tcaccgactc atggcgcaag gcccagaagg atggcaagac cgatgagaag      1080
     ggcggtggtc agtactactt cgacagtgag aacaaccttt tctggacctg ggataccccc      1140
     gaaatgatcg cccgcaagtt caaggagatc gttgcggaga agaagcttgg tggtgtcatg      1200
     gcttggagct tgggagagga tacctacaag tttgagcact tggaggctat gcagaagggt      1260
     atcaagtctc agtctaactc tccgaaggtt gaggagcccc ccgtggcgga gagaggctgt      1320
     gcctag                                                                 1326
//

If you have problems or comments...

PBIL Back to PBIL home page