(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02380

AM920435.PC20G02380  Location/Qualifiers
FT   CDS_pept        complement(join(537709..539818,539884..540038))
FT                   /gene="Pc20g02380"
FT                   /locus_tag="PCH_Pc20g02380"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SPBC530.05 - Schizosaccharomyces pombe"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02380"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85567"
FT                   /db_xref="GOA:B6HEE0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE0"
FT                   /inference="similar to AA sequence:PIR:T40521"
FT                   /inference="protein motif:PFAM:PF00172"
FT                   /inference="protein motif:PFAM:PF04082"
FT                   /protein_id="CAP85567.1"
FT                   /translation="MNERQRVWRACQICRRKKVKCDGEHPCESCTRNQAECVYIDPSVN
FT                   MRMVDPQYLMKLERQIQLMEKRLHQQSQAQPSTGHDDQLSENVQAGEEDLDSGGAMLRS
FT                   VPRPIAANVSHSDDANHGPCLLPDQPADGLHEGPEAQQQEDVVTAPQPPEPAAIDVTRL
FT                   PEPLLRLMIDLFYRSIYPIFPIISQRDFQPQFDRWLSAHQGCLGSEDDDFLLLLYALLA
FT                   VASFLLPEEHAIFDQPHLKAYKRVDLGGLLCSHATSKFPGRPTAHNATSATNLVVAQGL
FT                   LTFYLTECGKVNDAWITVGHAIRLYQALDLENGVDAAAEVEARCGVHGNIWWCLYILDR
FT                   SLSTALLKPLAIDNSESNMDHYDGESQLTLIPEDKIDPWFAVIAEFHIIMGRIYKSVRW
FT                   IRRRHQPQNAAHGDNSMLQSYMKKYDTELQTYYTKRVLPKMEGPHSAARPLALQNVAES
FT                   SYYIGIVLLYRTFIERLKIEDPEVFLRCAEAASNCIRVTPQVMATVPASHFVIQQCRAV
FT                   YTSTKVLLHCIRMAKNTGYTNKAWPDVQRGCDMLRKTKIQWPEVKRYQQVTEEDMYLTQ
FT                   VHLSKHELFHRVFGRYGMESQIRPSGNGETNHGSPCRTRTSHTDRPQGSPGVADNDAIS
FT                   SHRDPLNNAPEVDLTRTPQSLLSHNYGQESRLPERQPKRRRLSQNFNVHPAPSPYYALN
FT                   TPPILSEADRLPMLNAAIGSSDFLLPGIPPLPSVPRDCTPDLLDDSMLMSSFDLFFSHS
FT                   E"
     atgaacgaac gtcagcgggt ttggcgcgcc tgtcagatat gtcgacggaa gaaagtcaag        60
     tgtgatggcg agcatccatg cgagagctgc actcgcaacc aggctgagtg cgtctatatc       120
     gacccgtccg tcaacatgag gatggtggat ccgcaatatc tcatgaaact agagagacag       180
     atccagctga tggaaaagag attgcatcag cagtcacaag cacagccatc aaccggtcat       240
     gacgaccaac tcagtgaaaa tgtccaagca ggcgaggaag acctagacag cggaggagca       300
     atgcttcgat ctgtacctcg tccgatagct gcgaacgtgt ctcatagcga cgatgccaat       360
     catggtccct gtttattgcc tgaccagccg gcagacggtc tccatgaagg ccctgaggcc       420
     cagcagcagg aagacgtggt gacggcccca cagcccccag agcccgctgc gatcgacgtg       480
     acccgattgc cggagcccct tctacggctc atgattgacc tattttaccg ttccatatat       540
     cccatattcc ccattatcag ccaacgtgat tttcagccgc aatttgatcg ctggttatcg       600
     gctcatcaag gctgccttgg cagcgaggac gacgactttt tgctgctctt atatgcactg       660
     ctcgccgtgg catccttcct gctgccagaa gagcacgcta tctttgacca acctcaccta       720
     aaagcttata aacgagtgga cctaggaggt ctgctgtgct cccatgcgac ttccaagttt       780
     ccgggacggc caactgcaca taatgccacg tcagccacca acttggttgt tgcgcaaggc       840
     cttctaacct tctatctcac cgagtgtggc aaggtgaacg acgcttggat cacagttggc       900
     cacgcgatcc gcctatatca agcattggat cttgaaaatg gtgtggatgc ggcggccgaa       960
     gtggaggcga gatgcggcgt acatgggaac atttggtggt gtttatatat cctggaccga      1020
     tctttgtcga cagcgctcct taagccgttg gcgatcgaca actccgaaag caacatggat      1080
     cactatgatg gagagagcca attgactttg ataccggagg acaagatcga tccctggttc      1140
     gcagtcattg ccgagtttca catcatcatg ggtcgtattt acaagtccgt gcggtggatt      1200
     cgcagacgcc accagcccca gaatgctgcg catggggata acagcatgct gcagtcatac      1260
     atgaaaaagt atgatactga gctgcagacg tactacacca agcgtgtcct gcctaaaatg      1320
     gaaggacccc atagtgcggc tcggccgctc gcactacaga acgttgccga gtcatcttac      1380
     tatatcggaa ttgtgcttct ctaccgcacg tttattgagc ggctcaaaat tgaggaccct      1440
     gaagtgttct tacgttgcgc cgaggccgcg tcaaactgca tcagggtcac tccgcaagtg      1500
     atggccactg tgcctgccag tcactttgtg atccaacagt gtcgggcggt atatacgagt      1560
     accaaagtcc tcttacattg catacgcatg gcgaagaata caggctacac caacaaggcc      1620
     tggcccgatg tccagagagg ctgcgacatg ttgcgaaaga caaagattca gtggccggag      1680
     gtcaagagat atcaacaagt cactgaagaa gacatgtatc tgacgcaggt tcatcttagc      1740
     aaacacgagc tattccatag agtgttcggt cgatacggca tggagtccca aataaggcca      1800
     tcaggaaacg gcgaaacgaa tcacgggtcg ccgtgcagaa ccaggaccag ccacactgac      1860
     aggccccaag gttcgccggg cgtcgctgac aatgatgcca tttctagtca ccgggaccca      1920
     ttgaacaatg cccctgaggt ggatctaaca aggacgccac agagtctctt atcacataac      1980
     tatgggcaag agtcacgact tcctgaaaga caaccaaagc ggcgcaggct atcacagaat      2040
     ttcaatgtcc atcctgctcc ctccccctac tatgcgctga acacgccgcc catactttct      2100
     gaagcagaca gattgcctat gctgaacgcg gccattggct ccagcgattt ccttctaccc      2160
     ggtattcctc ctctgccgtc cgtaccgcga gattgtacac cagacttgct tgacgatagt      2220
     atgctcatgt catccttcga tctattcttc tcacattccg aatga                      2265
//

If you have problems or comments...

PBIL Back to PBIL home page