(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02410

AM920435.PC20G02410  Location/Qualifiers
FT   CDS_pept        join(544742..544771,544857..544944,545000..546244,
FT                   546295..546431)
FT                   /gene="Pc20g02410"
FT                   /locus_tag="PCH_Pc20g02410"
FT                   /note="unknown EC_number=1.2.1.16"
FT                   /note="Title: strong similarity to succinate-semialdehyde
FT                   dehydrogenase NAD(P)+ gabD - Escherichia coli"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02410"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85570"
FT                   /db_xref="GOA:B6HEE3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEE3"
FT                   /inference="similar to AA sequence:PIR:F65045"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /inference="protein motif:COGS:COG1012"
FT                   /protein_id="CAP85570.1"
FT                   /translation="MATQYQLPFKLSDPSLLKFDSVIGDKWVGAKSGKRFEVLDPGTDK
FT                   PWASCPANAAEDVSAAVENAHTAFEQFRKVNPRQRAKWLLEWHNLTVAARDDLAQIVTH
FT                   ETGKPLSEAYGEIDYSLGFLWWFAGEAERIQGSVSTAAAPNRRIFTIKQPIGVAAALVP
FT                   WNFPVAMVLRKVGAALAAGCTMVVKPSPETPISALVLAELAHRAGIPAGVLNVLTTDLE
FT                   NTPALSEALCKHPLVKKVTFTGSTRVGKLVASHCAHGLKKLTLELGGNCPFLVFDDANL
FT                   DQAVEQLMSLKWRHAGQACITANRIYVQAGIYDRFAALLKERTAAIVVGHGAVAGTTMG
FT                   PLTTPRSLDKASAQVEDALRLGADVILGGKAVTSQPGYFFEPTILSGMTEEMLISQEES
FT                   FAPIAALYRFETEEQTVKLANDTSMGLASYAFTKNIDRMWRLLENLEAGMIGMNTGNSS
FT                   AAESPFGGLKESGYGKESGKDVAVNEYLVTKTGTLTIEGQY"
     atggcgactc agtaccagct accattcaag ctatcggacc ccagtctgct gaaattcgac        60
     tccgtcatcg gcgataaatg ggtcggcgca aagagcggaa agcgatttga agtactcgac       120
     cccggcaccg acaaaccctg ggccagctgc cccgccaacg cagcagaaga tgtatctgcc       180
     gccgtggaga acgcccacac agccttcgag caattccgca aagtcaaccc tcgccaacgc       240
     gccaagtggc tactagaatg gcacaacctg accgtcgcgg cccgcgacga cctcgcccag       300
     atcgtaaccc acgaaaccgg caagccgctg tcagaagcat atggcgagat cgactattcc       360
     ctcgggttcc tgtggtggtt cgccggagaa gcagagcgca tccagggcag cgtgtcaaca       420
     gctgccgcac ccaaccgccg catattcacc atcaaacagc cgatcggcgt cgcagccgcc       480
     ctcgtcccat ggaacttccc cgttgccatg gttcttcgga aagtcggcgc tgcgctagcg       540
     gctggctgca cgatggtcgt taaacctagt cccgagacac cgatttcggc gctcgtgctg       600
     gcggaacttg cccatcgcgc tggtatcccg gctggtgtgc tgaatgtgct cactacagac       660
     ttggagaata ccccggcgct gagcgaggcg ttgtgtaagc acccgctcgt taagaaagtg       720
     acgttcacgg gctccacgcg ggtgggtaag ttggtggcct cgcactgtgc gcatggtctt       780
     aagaaattga ctcttgagct cggtgggaac tgtcctttcc ttgttttcga cgatgccaac       840
     ctcgaccagg cggttgagca gctgatgtcg ctgaaatggc gccatgcggg ccaagcttgt       900
     attactgcca atcggatcta cgtccaggct ggtatttatg atcgcttcgc tgctcttctg       960
     aaagagcgca ctgctgcgat agttgttggc catggcgccg tggctggtac cacaatggga      1020
     ccattgacca cgcctcggag tcttgataag gcctctgcgc aggttgagga tgctcttcgg      1080
     ctcggtgctg atgttatctt gggtggtaag gctgtgacgt cgcagccggg ttatttcttc      1140
     gagcctacta ttctgtcggg aatgacggag gagatgctca tctcacagga agaatcgttt      1200
     gcgcctattg ctgcgctgta ccggttcgag actgaggaac agactgtcaa gctggctaat      1260
     gatacgagca tgggtctggc tagttatgct ttcaccaaga atattgatcg catgtggcgt      1320
     ctgttggaga acttggaggc gggaatgatt ggaatgaata caggcaactc atcggccgcc      1380
     gagtcacctt tcggtggtct caaggagtct ggttatggca aagagagtgg gaaggacgtg      1440
     gctgtcaatg agtacttggt tactaaaacg ggcactttga ccattgaggg acaatattaa      1500
//

If you have problems or comments...

PBIL Back to PBIL home page