(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02530

AM920435.PC20G02530  Location/Qualifiers
FT   CDS_pept        complement(join(571971..572158,572221..574056,
FT                   574130..574301))
FT                   /gene="Pc20g02530"
FT                   /locus_tag="PCH_Pc20g02530"
FT                   /note="Title: similarity to multidrug resistance protein
FT                   Hol1 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02530"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85582"
FT                   /db_xref="GOA:B6HEG9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEG9"
FT                   /inference="protein motif:COGS:COG0477"
FT                   /protein_id="CAP85582.1"
FT                   /translation="MEERTGSDPVQSQPTASRWRRVFGGKAKEDPESGEGQTYRSKSTL
FT                   GILSDKETDEVPGTVLLLSSNRNEPLGMRHQPHRTSTSSITSSYRPSRSNSRTRSAVPT
FT                   QKKTADGQFVLDPQPDDSVNDPLNWPVWQRDAALVSLGFYCLMGGGMTPILAAGFNDVA
FT                   AAYDVSTQQVAFTTGFYMLGLGLGSVVMSPTAILYGKRPVYLLGATLFVVSAVWCAASP
FT                   NYPSLVVARIFQGLAVSPVECLPSATIAEIYFLHERAYRVGIYTLLLLGGKNLIPLVSA
FT                   AIIESLSWRWVFWIVAMIVGMCLVLLFFFVPETFWDRTPRPRVPKQKRPRGPGRSVSDI
FT                   VSHGFRGRRPYVQPQDESTEQDLHDPALAPKKSKHAHVGFADDHPEEGGHAIEPEKSDL
FT                   VPEAGNATNGEQSTNNPPTPSNEKGDDFLQPLPQALVPGAHPDDLETARRAAISPARTE
FT                   SLEPASTPLTATLQYTNRLRERPKIPYSQLLKVWNGRIAQDSWVRVAARPFVLFAYPAV
FT                   LWSTVVYSLSVGWLIVLSESVAHIFQSKDHYNFTSLQTGLIYISPFVGGLLGTAVAGKV
FT                   SDVIARFMTRRNGGVYEPEFRLVMAIPIALSTVIGLMAFGWSAEIGDSWIVPTVFFGLI
FT                   SFGCCLGSTTAITFCVDSYRQYAGEALVTLNFSKNILHGLIFSLFIVDWLDTNGSRTVF
FT                   LSIGGIQLFFMLMSIPMYLYGKRARMWTVRKRLMERL"
     atggaggaaa gaacgggctc agaccctgtc cagtcgcagc caactgcctc ccgctggaga        60
     cgagtctttg gaggaaaggc caaagaagat cccgagtctg gcgagggtca gacttatcgc       120
     tccaagtcga cactgggaat cctgagtgat aaagagactg acgaagttcc tgggacggta       180
     cttctcctat catcaaatcg caatgaacct ttgggaatga ggcatcagcc gcaccggaca       240
     tcaacatcgt ctataacctc atcttatcgt ccctcgcggt ctaattctcg aacccggtcg       300
     gcggttccaa cgcagaagaa aacagcggac ggacaatttg tgcttgatcc ccagccggac       360
     gactccgtaa atgacccttt gaactggcct gtatggcagc gtgacgccgc attggtctcg       420
     ctaggcttct attgtttgat gggaggcggc atgaccccca ttttggcagc agggtttaat       480
     gacgttgcag ctgcgtacga tgtcagtaca cagcaggtgg ctttcaccac cgggttctat       540
     atgctaggtc taggcctggg gtctgttgtg atgtcaccca ctgccatcct atacgggaaa       600
     cgaccggttt atctcttggg agcgactctg ttcgtggtct cggcagtttg gtgcgcagcg       660
     tcaccgaact acccaagtct cgtggtcgct cgtattttcc aagggcttgc cgtaagccca       720
     gtcgagtgtc ttccatctgc tacaattgcg gagatctact tcttgcacga acgagcctat       780
     cgagtgggaa tatacacact cttactacta ggtggaaaga acctgatccc cttagtgagt       840
     gccgccatca tcgaaagcct gagctggcgc tgggtatttt ggattgtagc catgattgta       900
     ggcatgtgcc tagtcctgct cttcttcttt gtgcccgaaa cattttggga tcgcacaccc       960
     cggccgcgtg tgcccaagca gaagcgcccg cgtggccctg gtcgcagtgt ctctgatatc      1020
     gtttcccacg gcttccgcgg gaggcgcccg tatgttcaac cccaggacga gtccaccgaa      1080
     caggatctgc atgatccagc attggcaccg aagaagtcca agcatgcgca tgttggattc      1140
     gcggatgacc acccagaaga gggaggccac gcaatcgagc ctgaaaagtc agatctcgtt      1200
     cccgaggccg gcaatgctac caatggagaa caaagcacca ataacccgcc gaccccatct      1260
     aacgagaagg gtgatgactt cctccaacca ctacctcagg cccttgtacc tggcgcacat      1320
     ccagatgacc tggagacagc tcgacgggct gcgatatcac ctgcgaggac cgagtcacta      1380
     gagcctgcta gcacaccgtt gacagcaacc ctgcaataca caaaccgact ccgtgaacgt      1440
     ccgaagatcc cctactccca gttactcaag gtctggaacg gccgaatcgc gcaggacagc      1500
     tgggtccgag ttgccgcgcg gccatttgtc ctatttgctt atccagcagt tctctggtca      1560
     acagtggttt actcactgtc tgttgggtgg ctgatcgtgc tttcagagtc ggttgcacat      1620
     atctttcaaa gcaaagacca ctacaatttc acctcgctcc agacaggcct gatctatata      1680
     tcgccgtttg ttgggggtct cctgggaact gcagtggcag gcaaagtatc ggacgttatc      1740
     gcgcggttta tgaccagacg caatggcggc gtctacgagc ctgaattccg tctcgtcatg      1800
     gcaattccca ttgctctgtc tactgtcatt ggtctgatgg cttttgggtg gagtgccgag      1860
     atcggcgact cttggattgt cccgactgtt ttctttggat tgatatcgtt tggttgctgc      1920
     ttgggcagca cgactgctat caccttttgt gtagatagct atcgccagta tgccggcgag      1980
     gcgctggtga cgctgaactt tagcaagaat atcctccacg gcctgatttt ctcccttttc      2040
     atcgtggact ggctcgatac caatggttca cgcactgtgt tcctgtctat tggtggcata      2100
     cagctcttct tcatgctcat gtcgatcccc atgtacctgt acggcaaacg agctcgtatg      2160
     tggacggtgc gcaagcggct catggaacgg ctttaa                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page