(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02620

AM920435.PC20G02620  Location/Qualifiers
FT   CDS_pept        complement(join(596131..596174,596276..596584,
FT                   596655..596946))
FT                   /gene="Pc20g02620"
FT                   /locus_tag="PCH_Pc20g02620"
FT                   /note="Title: similarity to glucoamylase III Wsc2
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85591"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEH8"
FT                   /inference="similar to AA sequence:PIR:S63257"
FT                   /inference="protein motif:PFAM:PF01822"
FT                   /protein_id="CAP85591.1"
FT                   /translation="MHTNYFFSALALALPVYSLSATARMGCYSEVDSFKNQGPYTYQSP
FT                   GYCQTECAENGFKVAALSRGNMCYCGNKMPSDSAKVADDKCDLSCSGWPAESCGGQDTF
FT                   NIIQATENLQASASENASTTIAPTAATAAGGIIVAPSTASSQTGIVTAASTASSKGGNV
FT                   VSKAAGSGSVATASPTPTYNAAGTVRAGSSLLGAVVAVILYPSLVRQQDVS"
     atgcatacca actacttttt ctcggccctt gccctagctc ttcccgtgta ctcgcttagc        60
     gccaccgcta ggatgggctg ctattccgaa gttgactcgt ttaagaacca aggcccctac       120
     acctatcaat cgccgggata ttgccagacc gaatgcgcag agaacgggtt caaggtcgca       180
     gctctgagcc gtggcaacat gtgctactgc ggcaacaaaa tgccctcgga ctctgcaaag       240
     gtcgccgacg ataagtgcga cctgtcctgc tccggatggc ctgcggagag ctgcggcgga       300
     caggatacct tcaacatcat ccaggcaact gagaacctac aagcctctgc atctgaaaat       360
     gcttccacta ctattgcccc cactgctgcc accgcagctg gtggaatcat cgtcgcgccc       420
     tcgacagcta gctcgcaaac cggcatcgtg accgcggcat caactgctag ctctaagggt       480
     ggtaacgttg tatccaaggc tgctggctcc ggctctgttg caactgcctc gcccacgccc       540
     acgtataacg cggccggaac agtccgcgcg ggatcatcgc tgcttggcgc tgttgtcgcg       600
     gttatactat acccctcgct ggttcgtcaa caggacgtct cgtga                       645
//

If you have problems or comments...

PBIL Back to PBIL home page