(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02650

AM920435.PC20G02650  Location/Qualifiers
FT   CDS_pept        join(604763..604811,604892..604964,605095..605275)
FT                   /gene="Pc20g02650"
FT                   /locus_tag="PCH_Pc20g02650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85594"
FT                   /db_xref="UniProtKB/TrEMBL:B6HEI1"
FT                   /protein_id="CAP85594.1"
FT                   /translation="MPSTLTGRLKKGIKGIGPSETRMPECALYGGISKRLGILEGKGDR
FT                   GVVTVKKVVYFPRMAQMQSQIPKTRSGSFRKKRHAFRLHGRQAAVYADRRNEWRQ"
     atgcccagca ctctgacggg gcggctgaag aaagggatta aagggatcgg cccctctgag        60
     acccgcatgc cagaatgcgc tctctacggg ggaatatcaa agcggcttgg cattttagaa       120
     ggaaaggggg atcggggtgt agtgaccgtg aaaaaggtgg tgtactttcc tagaatggct       180
     caaatgcaaa gtcaaatccc aaaaacgcgg tctggcagtt tccggaagaa acggcatgcc       240
     ttcaggttgc atggaagaca agcagcggtc tatgcagatc gaagaaatga atggcgtcag       300
     tag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page