(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02670

AM920435.PC20G02670  Location/Qualifiers
FT   CDS_pept        complement(join(609746..610036,610143..612422))
FT                   /gene="Pc20g02670"
FT                   /locus_tag="PCH_Pc20g02670"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig1487_1.tfa_1240wg - Aspergillus fumigatus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02670"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85596"
FT                   /db_xref="GOA:B6HES2"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES2"
FT                   /protein_id="CAP85596.1"
FT                   /translation="MSLQVNDPRSRTRSKSPGRSRSRSRSRDSRVPSPSPSPSHRSRSP
FT                   AVEVPRTKGYNPDEEAEIERQYKLISERRRETNDEPPVIPRAPRSSRYDVDRSDSDSES
FT                   RRRDVESARRRRDDRYEHSDEERGSAAASSRSHRRRPSPDRGSRVNHHDSDSDDDLAYG
FT                   DAPGTHPSYARPNRYSYAQPTQFASAAPGYPAAPGYPAAPGYPAAPIDWASVPECERPG
FT                   FVPPSSQPAAPATMPGAFPVASTYPASSGAVPAPVNPSLQYTGLPAQYATSAGYAPSHY
FT                   RTASASDAGYAPPAAGYANPGVYQYAQIDPNVKYSSKPVPVPTTAPASKPIYPAATHEQ
FT                   FSRPMPQQLQQQPPDQSYRYKHEPQRQEPQKQEPQFVEIAPGSRSSARPHSHSPSSSSL
FT                   AVGGASAAHSAHPPASPLLEPYHGTYQSMSPMPSPIVIPSIRDDDISDLEPLDGGTSAS
FT                   ESGRRSKHSRSHSSVGEKESRSRSSRDKERDNGKEDKRITRPAASHNRHDSSSSILSSD
FT                   ARVLISPTTGRKRVSFYDAGPDAAAMHSALNHARNIDNKTIIQVLPRLTSDEILLLRQE
FT                   YKTRVRMQGKGINLAKHLRLKLGSSSFGKVCYATALGRWESEAYWANCYYQAGTSRREL
FT                   LIESLMGRSNAAIREIKNSFRDTRYDNSLERCMRAELRADKFRVAILLALEGQRQDERE
FT                   PLDRRLVRHDVQDLHHAIVREGGETAMIHIIVSRSDSHLREVLRAYEDNYGHNFTRAMI
FT                   SKSRNLVGETLAHILNGAINRPMRDALLLHQALRESRTGRERSELLISRLVRLHWEPRH
FT                   LDLVKNEYRRRYHERLEEAIAEEILSLNGGQNWGEFCIELARNA"
     atgtccctcc aagtgaacga cccacggtcg cgaacccgat ccaaatcccc tggccgctcg        60
     cgctcacggt cgcggtcgcg ggacagccga gtcccctcgc cctcgccctc cccctcccac       120
     cgctcgcgct cgccagccgt cgaagtcccc agaacaaaag gctacaaccc agacgaagaa       180
     gccgaaatcg agcgccaata caagctcatc agcgagcgcc gtcgcgaaac caacgacgaa       240
     ccccccgtca tcccgcgcgc cccaagaagc tcccgctacg acgtggaccg ctcagactcg       300
     gactcagagt cgagacgtcg cgacgtagag agcgcaagaa gacgtcggga tgaccgctat       360
     gaacactcgg atgaggagcg cggttctgct gcggcttcgt cgcgatcgca tcgacgacga       420
     ccctcgccag accgcggcag tcgcgtgaat caccacgact ccgactccga cgacgatctg       480
     gcttacggtg atgcgccagg tacgcatcct agctatgcgc gcccaaatcg gtacagctat       540
     gcccagccca cgcagttcgc atccgctgcg ccgggatacc ctgctgcgcc gggataccct       600
     gctgcgccgg gataccctgc tgcgccgatt gactgggcct ccgtgccgga atgtgaacgc       660
     ccaggtttcg tgccgccttc atcccagcct gcggccccgg ctacgatgcc cggtgcgttc       720
     cctgtggcct cgacctatcc cgctagctcg ggtgctgtgc cagcgcctgt caacccctcg       780
     ctgcagtata ctggcttgcc cgcccagtat gcgacgagtg cgggttatgc gccttcgcat       840
     tatcgcactg cctcggctag tgatgctggt tatgcaccgc cggccgcggg atatgcgaat       900
     cccggcgtat accagtacgc tcagatcgat cctaatgtga agtactcttc gaagccggtg       960
     ccggtgccaa cgacggcgcc tgcgtctaag ccgatatatc ccgctgccac gcatgagcag      1020
     ttttctagac cgatgccgca gcaattgcag cagcaacctc cggaccagtc gtaccggtat      1080
     aagcacgagc ctcagagaca ggagcctcag aaacaggagc ctcaatttgt ggagatcgcg      1140
     ccaggtagcc ggtcgtctgc gcgtccgcac agtcactctc cgtcgtcaag tagcctcgca      1200
     gttggcggag ccagtgcagc tcactcggct catcccccgg ctagtccgct gctagagccg      1260
     tatcatggta cttaccagtc catgtcaccc atgccatccc cgatcgtcat cccctcgatc      1320
     cgcgatgatg acatttcaga tctcgaacca ctggacggcg gaacctcagc ctccgagtca      1380
     ggccggcgca gcaaacacag tcgctcccac tcatccgtcg gcgagaaaga gtcccgctcc      1440
     cgcagcagca gagacaaaga gcgcgacaac ggcaaagaag acaaacgtat tacccgccca      1500
     gcagccagcc acaaccgcca cgactcaagc tcctccatcc tcagctcgga cgcaagagtc      1560
     ctaatctccc caacaaccgg tcgcaaacgt gtctccttct acgacgccgg ccccgacgcc      1620
     gcagccatgc actccgccct aaaccacgca cgcaacatag acaacaaaac catcatccaa      1680
     gtcctgcccc gactaacaag cgacgagatc ctcctcctcc gccaggaata caaaacccgc      1740
     gtgcgcatgc aagggaaagg aataaacctc gccaaacacc tccgcctcaa actcggcagt      1800
     tcctccttcg gcaaagtctg ctacgcaacc gccctgggtc gctgggaatc agaagcatat      1860
     tgggcaaact gctactacca agcgggcacc tcgcgtcgcg agctcctaat cgagtccctg      1920
     atgggccggt cgaatgccgc catccgcgaa atcaaaaact ccttccgcga cacccgctac      1980
     gataacagtc ttgagcgctg tatgcgcgcc gagctgcgcg cagataagtt ccgcgtggcg      2040
     attctgctcg cgctcgaggg tcagaggcag gatgagcgcg agccgctcga tagacgtctt      2100
     gtcagacatg atgtgcagga tttgcatcac gcgattgtga gggagggcgg cgagaccgct      2160
     atgattcata ttattgtttc gaggagtgat tcgcatctgc gtgaggtgct gcgcgcttat      2220
     gaggataact atggtcataa ttttactagg gctatgattt cgaagtcccg caacctggtc      2280
     ggcgaaaccc tcgctcacat cctcaacggc gcaatcaaca gacctatgcg cgacgccctc      2340
     ctcctccacc aggccctccg cgaatcccgt actggccgcg aacgctccga gcttcttatt      2400
     tcccgtcttg tgcgtctgca ttgggagcct agacatctcg atcttgtcaa gaatgagtac      2460
     aggcgcagat accatgagcg tctggaggag gctattgctg aggagatcct ctccctgaat      2520
     ggcgggcaga attgggggga gttctgtatt gagctggcgc gtaatgcttg a               2571
//

If you have problems or comments...

PBIL Back to PBIL home page