(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02740

AM920435.PC20G02740  Location/Qualifiers
FT   CDS_pept        complement(join(624401..624809,624910..625008,
FT                   625086..625104,625161..625198,625256..625263))
FT                   /gene="Pc20g02740"
FT                   /locus_tag="PCH_Pc20g02740"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the small subunit S9 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02740"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85603"
FT                   /db_xref="GOA:B6HES9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B6HES9"
FT                   /inference="similar to AA sequence:TREMBLNEW:BC007857.1"
FT                   /inference="protein motif:PFAM:PF00163"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /inference="protein motif:COGS:COG0522"
FT                   /protein_id="CAP85603.1"
FT                   /translation="MAPRVSSKTYKVPRRPFESARLDAELKTVGEFGLRNKREVWRVQL
FT                   TLSKIRRAARELLTLDEKDPKRLFEGNALIRRLVRIGVLDEGRMKLDYVLALKADDFLE
FT                   RRLQTCVYKLGLAKSIHHARVLIKQRHIRVGKQIVNVPSFMVRLDSQKHIDFSLTSPFG
FT                   GGRPGRVRRKKAAAAAGGEDAEEEEEE"
     atggcccctc gcgtttcctc caagacctac aaggtccccc gtcgcccctt cgagtcggcc        60
     cgtcttgatg ctgaactcaa gaccgtcggc gagttcggtc tgcgcaacaa gcgcgaggtg       120
     tggcgtgtcc agctcaccct ctccaagatc cgtcgtgctg ctcgtgagct ccttactctc       180
     gacgagaagg accccaagcg tctcttcgaa ggcaatgccc tcattcgccg tcttgtccgc       240
     atcggtgtgc tcgacgaggg ccgcatgaag ctcgattacg tccttgccct caaggctgac       300
     gatttcctcg agcgccgtct ccagacctgc gtctacaagc ttggtctcgc caagtccatc       360
     caccacgccc gtgtcctgat caagcagcgt cacatccgcg tcggcaagca gatcgtcaac       420
     gttccctcgt tcatggtccg cctcgactcc cagaagcaca tcgacttctc tctcacctct       480
     cccttcggtg gtggccgtcc cggccgtgtt cgccgcaaga aggccgctgc cgccgccggt       540
     ggtgaggacg ccgaggagga ggaggaggaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page