(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02750

AM920435.PC20G02750  Location/Qualifiers
FT   CDS_pept        join(626863..626898,627017..627084,627153..627200,
FT                   627316..627646)
FT                   /gene="Pc20g02750"
FT                   /locus_tag="PCH_Pc20g02750"
FT                   /note="Title: strong similarity to cytoplasmic ribosomal
FT                   protein of the large subunit Urp1 - Saccharomyces
FT                   cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85604"
FT                   /db_xref="GOA:B6HET0"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:B6HET0"
FT                   /inference="similar to AA sequence:PIR:S28921"
FT                   /inference="protein motif:PFAM:PF01157"
FT                   /inference="protein motif:COGS:COG2139"
FT                   /protein_id="CAP85604.1"
FT                   /translation="MPHSYGLRAGTRYAFSRGFKEHGMIRLSTYMKTYRVGDIVDLKVN
FT                   GAVQKGMPHKVYHGKTGVVYNVTKSAVGVILYKKVDNRYLEKRISVRIEHVQHSRSRED
FT                   FIKRVKENAIKKREAKEKGVHVHLKRQAVGPREAHFVKQAGNKPETVVPIAYDTHI"
     atgcctcact cgtacggtct gcgcgccggc actcggtatg ccttcagccg tggcttcaag        60
     gagcacggta tgatccgtct ctccacctac atgaagacct accgtgttgg tgatattgtc       120
     gaccttaagg tcaacggtgc cgtccagaag ggtatgcccc acaaggtcta ccacggtaag       180
     accggtgttg tctacaacgt caccaagtcc gccgtcggtg tcatccttta caagaaggtc       240
     gacaaccgct acctcgagaa gcgtatcagc gtccgcattg agcacgtcca gcactcccgc       300
     tcccgtgagg acttcatcaa gcgggtcaag gagaacgcca tcaagaagcg cgaggccaag       360
     gagaagggtg tccacgttca cctgaagcgt caggccgttg gtccccgtga ggcccacttc       420
     gtcaagcagg ctggcaacaa gcccgagacc gtcgtcccca tcgcctacga tacccacatt       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page