(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02870

AM920435.PC20G02870  Location/Qualifiers
FT   CDS_pept        join(657129..657190,657259..657667)
FT                   /gene="Pc20g02870"
FT                   /locus_tag="PCH_Pc20g02870"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   contig_1_81_scaffold_5.tfa_210cg - Aspergillus nidulans"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02870"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85616"
FT                   /db_xref="GOA:B6HF48"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF48"
FT                   /protein_id="CAP85616.1"
FT                   /translation="MPTIFPTWPHILFGVLEPISLALGSVFPLYDLEGFIAGQTPTIAA
FT                   PATLHPSSVALAYQLGNVYSLLFLVGVGVCHATTEPRVLRNYLIGLAIADVGHVYATYL
FT                   AMGWDAFADVGAWNALTWGNIGITMFLFVNRIAYFLGIFGYAKAPKAAAKRE"
     atgcccacta ttttcccaac atggccacac atcctatttg gcgtccttga acctatctca        60
     ctggccctcg gcagtgtctt ccccctctac gacctggaag gctttattgc cgggcagaca       120
     cccaccatcg cagccccagc caccttacac ccaagcagcg tcgcactcgc ctaccaactc       180
     ggcaatgtct attccctcct cttcctagtc ggtgtcggtg tctgccacgc cacaacagag       240
     ccaagggtgc tgcgcaacta tctaattgga ctggccatcg ccgatgtagg ccatgtctac       300
     gccacgtact tggcgatggg ctgggacgcg tttgcggacg ttggggcatg gaacgctttg       360
     acctggggta acattgggat cacgatgttc ctgttcgtta ataggatcgc ttatttcttg       420
     ggcatttttg gttatgcgaa ggcgcctaag gcggctgcaa aacgggagtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page