(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02890

AM920435.PC20G02890  Location/Qualifiers
FT   CDS_pept        complement(join(661670..661729,661767..661906,
FT                   662126..662252))
FT                   /gene="Pc20g02890"
FT                   /locus_tag="PCH_Pc20g02890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02890"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85618"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF50"
FT                   /protein_id="CAP85618.1"
FT                   /translation="MEGGEQNNLIDPNSILALGRPTFGSPLGILGIRFACSKRHTVVSP
FT                   RRTNGHIIWGMHNNAVVDYFLTVTPGTRNIERNILLPKVPNWSILELGSGSGILCITLH
FT                   FPLL"
     atggagggag gggaacagaa taatctgata gatccaaact caattctagc actgggccgt        60
     cccacgttcg gatcaccact ggggatactg gggataagat ttgcgtgttc caagcgccat       120
     actgttgtta gcccaagacg tacaaatggg catattatct gggggatgca caacaatgca       180
     gttgtggatt attttttaac cgtgacccct gggacccgga atattgagcg caatatactt       240
     ttacccaagg tgcccaattg gtcaatcttg gaactcggta gtggctctgg tattctctgc       300
     ataacgctgc acttcccatt attatag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page