(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02930

AM920435.PC20G02930  Location/Qualifiers
FT   CDS_pept        complement(join(667974..668141,668194..668375,
FT                   668427..669519,669560..669838))
FT                   /gene="Pc20g02930"
FT                   /locus_tag="PCH_Pc20g02930"
FT                   /note="Title: strong similarity to D-lactate dehydrogenase
FT                   dld - Kluyveromyces lactis"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02930"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85622"
FT                   /db_xref="GOA:B6HF53"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF53"
FT                   /inference="similar to AA sequence:PIR:S51528"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /inference="protein motif:COGS:COG0277"
FT                   /protein_id="CAP85622.1"
FT                   /translation="MRVLRVSRALPTPFCRPQISRTILARGARLNSSDAGTENTKESNS
FT                   SSQNTPPSPFWTPGKALLVSAFAAGLGYGVSSYTQTPTQTSKKPQYGSHNPRAIQTNNH
FT                   PQAINELRTKLDEDTISTDEDDLHQHGFSEWSSLNADRLPVAIAYPKTTQEVSEIAKVC
FT                   NKYRMPMIPYSGGSSLEANFSAPHGGMTIDFAFMNKVLEIHPDDMDVVVQPSIQWMDLN
FT                   EQIKETGMFFPVDPGPSAMIGGMVGTNCSGTNAVRYGTMKDWVINLTVVLADGRIIKTR
FT                   RRPRKTSAGYNLTGMFVGSEGTLGIVTEATLKLAPIPEQTRVGVVAFPTIRDAASTAMQ
FT                   LIRKGVSVQCMEIMDDVQMDVINRAGGTGREWKVSPTLFFKFSGTVAGVADSIDMTTKL
FT                   AQGNNAQSFEFARDDREAHDLWSARKQSLWSMMALRKEGSEVWSTDVAVPISRLPDIIE
FT                   ISKKELVDLGLFASILGHIGDGNFHASIMYDRNNPAERERVEKVVHDMVDRGLEMEGSC
FT                   TGEHGIGLGKKGSLKKEVGLDTINVMRSIKRSLDPNWLLNPGKIFDYDEETPGPGH"
     atgcgagtcc tccgggtctc acgagcgctg ccaactcctt tctgtcggcc ccagatctcg        60
     cgcactattc tagctcgcgg tgccagatta aacagttccg atgctgggac agagaacaca       120
     aaagagagca attcctcatc tcaaaacact cccccttcac ccttttggac cccgggcaag       180
     gctctactcg tctccgcatt tgctgcgggg ttaggctacg gcgtctcctc atatacccag       240
     acgccgacac agacgtccaa gaagccacaa tatggctcac ataatcccag agccatccaa       300
     actaacaacc acccccaggc catcaacgag ctaagaacaa agctcgacga agacacaatc       360
     agcaccgatg aagatgatct ccaccaacac ggcttctcag aatggtccag cctaaatgcc       420
     gaccgtctcc ccgtcgcaat cgcatacccc aagaccaccc aagaggtctc cgagatcgcc       480
     aaggtctgca acaaataccg catgcccatg atcccttact cgggcggatc gagtctggaa       540
     gccaatttct ccgccccgca cggcggaatg acaatcgact tcgccttcat gaacaaagtc       600
     ctagagatcc acccagacga catggacgtc gtcgtgcagc cctccatcca gtggatggat       660
     ctgaacgagc agatcaagga aacaggcatg ttcttccccg ttgacccagg cccatccgcc       720
     atgatcggcg gcatggtcgg cacaaactgc agcggcacca acgccgtccg ctacggtacc       780
     atgaaggact gggtgattaa cctcacggtc gtgctggctg atggccgcat catcaagacc       840
     cgccgacgtc cgcgcaagac ctccgccggc tacaatctca ccggcatgtt tgttggttcg       900
     gagggtacgc tcggtatcgt cactgaggct acgttgaagc tggctccgat cccggaacag       960
     actcgggttg gcgtcgtcgc gttcccgact attcgtgatg cggcctcgac ggcgatgcag      1020
     cttattcgga agggtgtctc tgtgcagtgc atggagatca tggatgatgt tcaaatggac      1080
     gtcattaatc gggcgggtgg aacgggccgc gaatggaagg tctctcctac gctgttcttc      1140
     aagttctcgg ggactgttgc tggtgtcgcg gatagtattg atatgacgac gaagctcgcg      1200
     cagggtaaca atgcgcagtc ttttgaattc gctcgggatg atcgcgaagc tcatgacctg      1260
     tggtcggcgc ggaagcagtc gctgtggagc atgatggcgc tgcgtaagga gggttcagag      1320
     gtctggtcga ctgatgtggc cgtgcccatt tctcggctgc ctgatattat tgaaatctct      1380
     aagaaggaat tggtcgacct aggccttttc gccagtatcc ttggccacat tggcgatgga      1440
     aacttccatg caagcattat gtatgaccgt aacaatcccg ccgaaaggga gcgagtcgag      1500
     aaagtagtac acgatatggt tgatcgtggg ctggaaatgg agggctcatg cacaggcgag      1560
     cacggcattg ggctgggcaa gaaagggtct ttgaaaaagg aggttggcct ggacacaatt      1620
     aatgtcatgc gcagtatcaa gcgttcattg gatccgaact ggctgcttaa cccaggcaag      1680
     atcttcgact acgacgagga aacaccgggc ccaggacatt ga                         1722
//

If you have problems or comments...

PBIL Back to PBIL home page