(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02940

AM920435.PC20G02940  Location/Qualifiers
FT   CDS_pept        join(670302..670311,670580..670653,670723..670849,
FT                   670900..670994,671056..671667,671721..671873,
FT                   671927..673147,673213..673341,673400..673516,
FT                   673571..674182)
FT                   /gene="Pc20g02940"
FT                   /locus_tag="PCH_Pc20g02940"
FT                   /note="Title: strong similarity to hypothetical protein
FT                   An11g09530 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02940"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85623"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF54"
FT                   /inference="protein motif:COGS:COG1196"
FT                   /inference="protein motif:COGS:COG1511"
FT                   /inference="protein motif:COGS:COG5022"
FT                   /protein_id="CAP85623.1"
FT                   /translation="MADAMEQLAQLVREVERIVTAPYVPSLQQSQSSTIGAWAFCKPCQ
FT                   LGLLADVFIEALSRSRVALPLITAFASTATFRDALLERHPVVLDAFLEKAMDTNGAEYL
FT                   PACIALFSSPLPAGVVPPARIAPFITKLVSMMAENPCVETVAPLQALISGLKGSPRILD
FT                   DIPSEVMSNLQLEFTKTLRNLDDHMGNLLCLATFAQIATALGTTSPNQHGSEAPWLLNI
FT                   KHFFGQKRGLKTLDLVVLRVILACSSSCNLAPPEAAESIRLAICIAGAIEPEQKQVWIA
FT                   GNNPKIAKLCEKAVRDGLCGQTQTMVIVFLHTLLPAHLLPSQLRELGLKVILSKNSQET
FT                   VGTIPHQLIPRLAKSLAESGELATRQLLTFTFDVLRSSKSSGMGEMATLQLAHLVLAGV
FT                   QDVHPEILLSCAKNSMVPLREVLGELVEHFPRRPSESQCSDRAWCASKLYTKQNRLFLS
FT                   LLGLYNMATAQSGSDLIMKSFMRRVEQSMPSLDCAFSTITSKAFRGSLTLRDRHDLWPT
FT                   KVNRNWRSGVTELFMQNAQTSHDSMMRKIEDTCSDLERRCYDVEGPLRAAEEERDIYAS
FT                   ENEQLKRQNKELNEQLCTNNTEVQTKLQNSHECFVELGHEKTRLEQLLQGQYEYTEELT
FT                   VSLASTREELQQQQRSSEKALLEEKEKARSKELEMMATLTGKDDQLEELQEEMCSLQMK
FT                   NEQTRQSLDQVTSEKAKLSEHCSSLEQELASATEALKQTRLLADEREDEVNRLLAQEEE
FT                   LRKELGTVETTVAQQNVEVERLYSTLEESEEGSRREIERLKHDREAEASRAASEIAKHE
FT                   TDNRRLHAAMQAAALDASKDAQLKDKRIQHLERKVQALRDERAAKAREFSEAQQHIGRL
FT                   MGVMGFSANAPESNAAPRHQRARSSANTTPAARIPQHISDDEDGTQLAQSFESITSNFH
FT                   EPTPKRPRGNRKSTNHPYNFDTPSAAAPKSKSPLRASDMSRSMRKPLAEADRNSPTKSQ
FT                   SSSALKRNQVDDAFQEMQTQENTEENRLHNLDLDMDLEFSRDFLFSSTAFTGSTDQIAP
FT                   Q"
     atggcggatg cgatggagca actcgctcaa ctagtgcgcg aggtggagcg catagtcacc        60
     gcaccttacg taccttcgtt acagcaaagc cagtcttcaa caattggcgc ctgggcattt       120
     tgcaaaccct gccaacttgg cttgttggct gatgttttca tcgaagcctt atcacggtca       180
     cgcgtcgctc tgccgctgat cactgcattt gcatctaccg cgacttttag ggatgcgctg       240
     ctcgagcgac atccggtggt tttggatgcc tttttagaaa aggccatgga caccaatggg       300
     gctgagtatt taccggcatg tatcgcattg ttctcatcgc ccttgccagc gggtgttgtg       360
     ccaccagcta ggattgcccc cttcatcacg aagctggtga gcatgatggc agagaatccc       420
     tgtgtcgaga ctgtagcacc tctccaagca ctcatctcag ggctcaaagg ctcaccaaga       480
     attttggatg atatcccatc cgaggtcatg tccaatctcc agctggagtt caccaagaca       540
     ctgcgcaacc ttgacgacca catgggcaac ctcttgtgcc tggcaacttt tgcgcagatt       600
     gcgacggcac taggcacaac atctccaaat caacacggat cagaagcacc atggcttctt       660
     aacattaagc atttctttgg ccagaaacgg ggtcttaaaa cacttgactt ggtcgtcttg       720
     cgtgttatac tagcttgctc atccagttgc aatctggcac cgcccgaggc ggctgagagt       780
     attcggctgg cgatttgcat cgctggagca attgaacccg agcagaaaca ggtttggata       840
     gccggtaata atcctaagat tgctaaactg tgcgagaagg ctgtcagaga cggtctctgt       900
     ggtcaaaccc aaacgatggt aatcgtcttt ttgcacacac ttcttccggc acatttgttg       960
     ccatcccagc tgcgggaact tggcctaaaa gtcattttgt ccaagaacag ccaagagact      1020
     gtgggaacta taccacatca actgattcca cgcctcgcga agtctctagc ggaatccggg      1080
     gaacttgcca ctcggcaact tttgaccttc actttcgatg tcttaagaag tagtaaatcg      1140
     tcgggtatgg gagagatggc aacattacaa ctggcacact tggtattggc cggtgtgcaa      1200
     gacgtacatc ccgagatctt gctttcttgt gccaagaact ccatggtccc tctaagagaa      1260
     gttcttgggg aattggttga acacttcccc cgacgaccaa gcgaaagcca gtgcagtgat      1320
     cgagcatggt gtgcatccaa gctatacacg aagcaaaaca ggctgtttct ctctctattg      1380
     ggactttaca acatggcgac agcgcaaagc ggaagcgacc ttatcatgaa gtcctttatg      1440
     cgacgagtgg agcaatcaat gccgagcctc gactgtgcct tctcaacaat aacttccaaa      1500
     gccttccgcg gctcccttac attgcgcgac agacatgacc tctggccgac caaagtaaac      1560
     cgcaattggc gctctggggt tactgagctc ttcatgcaga atgcccaaac ctctcacgac      1620
     agtatgatga ggaagattga ggatacgtgc tctgacctag agcgtcgctg ttacgatgtt      1680
     gaagggcctc tgcgagctgc cgaagaagag cgagacatat acgcgagcga aaacgagcaa      1740
     ctcaaaaggc aaaacaaaga gttaaacgaa caactgtgta ccaacaatac agaggtccag      1800
     actaagttac agaactcaca cgaatgtttt gttgaacttg gccacgagaa gacacgcctt      1860
     gaacagcttc ttcaaggtca atatgaatat accgaagagc tgactgtgtc gcttgcatcc      1920
     acacgcgagg agcttcagca gcagcaacga agttccgaga aggcgcttct tgaggaaaaa      1980
     gaaaaggccc gatctaagga attggagatg atggctactt taaccgggaa agatgatcaa      2040
     ctggaagagc ttcaggagga gatgtgcagt ttgcaaatga agaatgagca gacacgccag      2100
     agtcttgatc aagtcacgag cgaaaaggcc aaattatccg aacactgtag ctctctggag      2160
     caagaacttg ctagtgctac agaggcattg aagcaaacca ggcttcttgc tgatgagaga      2220
     gaggacgaag tgaaccgtct cctagcccag gaggaagagt tgcgaaagga actgggaacc      2280
     gtggaaacaa cagttgcaca gcagaacgtt gaagtcgaga ggctctattc cacattggaa      2340
     gaatctgagg aaggatcgcg gagggagatt gaaaggctga aacatgaccg tgaagccgaa      2400
     gcttctcggg ccgcatctga gatagcgaag cacgagacag acaatcggcg attgcatgct      2460
     gctatgcaag cagccgctct tgatgcttct aaagatgccc aattgaaaga caaacggatc      2520
     cagcacctgg agagaaaggt gcaagcctta cgagacgaac gtgctgccaa ggcccgtgag      2580
     ttttcagaag cacaacaaca catcggtcgt cttatgggcg tgatgggctt ctctgccaat      2640
     gcccccgaat caaacgccgc tccaagacac cagcgagcca ggtcctctgc caacaccacc      2700
     ccagctgcaa ggatcccgca acacataagc gacgatgaag atggcacgca gctggcacag      2760
     tcctttgagt ccataacctc caacttccat gaacctaccc cgaagcgacc aagagggaat      2820
     cgcaagtcaa caaaccaccc gtataacttc gacactccct ccgctgcagc tcctaagtca      2880
     aaatccccac tgcgggccag cgacatgtct cgctcgatga gaaagccact ggcagaggcg      2940
     gaccgcaaca gcccgacgaa gtctcagtca agcagtgcgt tgaaacgcaa tcaggtggat      3000
     gacgctttcc aggagatgca gacccaggag aatactgagg aaaaccgtct tcacaatctg      3060
     gatttggata tggatctgga gttttcaaga gactttctct tctccagcac tgcttttact      3120
     gggtcgacgg atcagattgc ccctcagtga                                       3150
//

If you have problems or comments...

PBIL Back to PBIL home page