(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02950

AM920435.PC20G02950  Location/Qualifiers
FT   CDS_pept        join(675232..675527,675586..675742,675796..676243,
FT                   676302..679507)
FT                   /gene="Pc20g02950"
FT                   /locus_tag="PCH_Pc20g02950"
FT                   /note="unknown EC_number=2.7.7.48"
FT                   /note="Title: strong similarity to RNA-directed RNA
FT                   polymerase like protein An11g09540 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02950"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85624"
FT                   /db_xref="GOA:B6HF55"
FT                   /db_xref="InterPro:IPR007855"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF55"
FT                   /inference="protein motif:PFAM:PF05183"
FT                   /protein_id="CAP85624.1"
FT                   /translation="MTGPDLPSLQHPKSNLLRMVPPNIPTPARRNPPVLDLPVRDWITW
FT                   RSWRTCAVDLLNLPREMNTHDIYDAFHRYGNMISIDLWEDASGRPDCKGRIRFKPPPTE
FT                   EFWRTGSFGVKLRSGRVAVISLSVCCGDSNGTIQSPVRPDIQLPGEVELKTVQVDIGVL
FT                   LGLSTFHSMQSFTNLAYPRCVVDVMRKCLFLYFRVGIRGSDTADVNQHDHRVKITFLQL
FT                   TQIYQQYDKATRERSLLIVLDSAAIWHRKAKDIQSTLTEPLSWREEDSWYRQTSVTHNP
FT                   NSLKTLPANLKKTGHIIDLGRWNVFKISFAPDVDPNVRRVDDTSHYLMRVEEIFKDYNI
FT                   TVQDGSHFVEKADRPVPVWHWIDFSESKSNKASALLQDLGNQNYLHLPFKVRYQLEVCL
FT                   SQGYLSEFTMTREFIETLKGLGDDQATRLLEFVATEKKQYLAPMEIFDLKFFKGVTDSR
FT                   IPNYCCFMRTARITPTTIYYNTPTVDISNRVVREWSTKGTPGRFLRVRFTDEKTEGRIN
FT                   ASQRGCNDEVYTRVKRTLANGIAIGDRHYEFLAFGNSQFREHGAYFVAPDAGISAGTIR
FT                   AWMGQFNHIRNVAKYTARLGQCFSTTRAFTGSSVQTIPCDDIIRNGFTFSDGVGKISKF
FT                   LAQMVTSQHDIKTLTGEPPSAFQFRLGGAKGMLVVSTDPLPQEVHIRPSQQKFETSQAG
FT                   LEIIRWSQYSLATLNRQIILVLSALGIPDEVFHSKLNTMLGSFHRAMLNDSKAINLLQK
FT                   YIDPNQMTLTLAQMVSDGFRRNEEPFVNTMLELWKSWHLKHLKEKAKIAIDQGANVLGV
FT                   MDETGVLKGYFRKELPSRRASYAEKLAALPEIFVQVCRLDGGGEYEVIEGLCILARNPS
FT                   LHPGDIRVVRAVNRSELHALRDVVVLPQTGDQDIASMCSGGDLDGDDYLVIWDPNLIPA
FT                   NWFVECMDYKGSKAPDLDHDVTVDEITSFFVTYMKNDCLPRIAHAHLAWADRLPRGVWE
FT                   DKCIRLAQLHSDAVDYNKSGAHARMARSLDPKFWPHFMEKRFKRPSSIYKSTKILGQLY
FT                   DAVITPDFVPKLEKPFDSRILESPLAPASEAYMEYARELKAEFDMNMRQIMAQYEINTE
FT                   FEVWSTFVLRHGFVIKDYKMQEDLGRIVGTLRRGFRHQCYDKVGRDGGNIPALVIAMYR
FT                   VTQEQVAAALEARRNEALQREDVSIAEVNSTELPLISFPWIFPDVLGDVATGRARQAMI
FT                   SDGQESADSAKPIGEGLVFTHKQILKIVEDMDGDIKSTAENMKLKDPKNMEPKAEAGSN
FT                   SAPPDQELIARRRIDKTKPKQKSEDRDTGLYIEEDDEKEGGVAIGSAKTEEKIDKREAV
FT                   TEDIVEMEGDVKPSALDDLIKMIGG"
     atgacaggcc cagatctccc cagtttgcaa cacccaaagt ccaacctctt gagaatggtt        60
     ccccctaaca tacctacccc tgcccgccgc aacccaccag tcctggactt accggtccgg       120
     gactggataa cctggagatc atggaggact tgtgcggtgg atctgttgaa cctcccaaga       180
     gaaatgaaca cccacgatat ctacgacgct ttccaccggt acggaaatat gatctccatc       240
     gatctttggg aggacgcctc ggggcgtccg gattgcaaag gacgcattcg gtttaagccc       300
     cctccaactg aggagttctg gagaaccggt tccttcggcg tgaagctacg gagtggtcgt       360
     gtggcagtga tatcactctc tgtctgttgt ggtgattcga acgggaccat ccagagccca       420
     gtccgtccag atatccagct ccctggtgaa gtggaattga aaactgtaca agtcgacatc       480
     ggtgtgctgc taggtctgtc cacttttcat tccatgcaga gctttaccaa cttggcgtac       540
     cccagatgtg ttgtggatgt catgcgcaag tgcttgtttc tttacttcag agtgggtatt       600
     cggggttcgg acactgcaga cgtaaaccag catgatcatc gtgtcaaaat cacattcctc       660
     caactgaccc agatttacca acaatacgac aaagccacga gagaacgttc cttattgatt       720
     gttctcgact ccgccgccat ctggcaccga aaggccaaag acatccagtc tacattgaca       780
     gagccgttga gctggagaga agaggatagt tggtatcgcc agacttccgt cacacataac       840
     ccgaactcgc taaagactct acccgccaat ctgaagaaga ccggacatat cattgacttg       900
     gggcgatgga acgtgttcaa gatctcattt gcacctgacg tggaccccaa tgtgcgtcgt       960
     gtcgacgata ccagtcacta tttgatgcgc gttgaagaaa ttttcaaaga ctataacatc      1020
     accgtccaag atgggagtca cttcgtcgag aaagccgacc gaccggtacc agtgtggcat      1080
     tggattgact tttctgagtc caagtccaac aaggcttccg cgttgctgca ggacttggga      1140
     aatcagaact atctacacct ccccttcaag gtccggtatc aactagaggt ttgtttgtcc      1200
     caaggatacc tctctgaatt caccatgacc cgcgaattca tagagacgtt gaaaggtctc      1260
     ggggacgatc aagctacaag actgctagag ttcgttgcca ccgagaaaaa acagtacctt      1320
     gcccccatgg aaatctttga cctcaaattc ttcaaaggag tgacggactc aagaattccg      1380
     aactactgtt gcttcatgcg caccgcgcga atcacaccaa ctacaattta ctacaacact      1440
     ccaactgtag acatctcaaa ccgagtcgtg cgcgaatggt ctacaaaagg tacacctggg      1500
     cgctttcttc gagttcgatt tacagatgag aagactgaag gtcgcatcaa tgcttcacag      1560
     agaggttgca acgacgaagt ctacacccgt gtcaaaagga cactggccaa cggcatcgcc      1620
     attggagatc gtcactacga gttcctcgca ttcggcaact ctcagttccg cgagcatggc      1680
     gcatacttcg ttgcaccaga tgccggtatc tcagcgggaa ctatccgggc ctggatgggg      1740
     caattcaacc atattcgaaa tgtggccaag tacactgcaa gactagggca atgcttttcg      1800
     accacccgag ctttcactgg atcctctgtt caaactattc cgtgcgacga cattatccgc      1860
     aacggcttca cattctccga cggtgttgga aagatttcca aattcctcgc ccagatggtc      1920
     acatcccagc acgatattaa gactctcact ggagaacctc catcagcttt ccagtttcgt      1980
     cttgggggag ccaagggcat gctggtggtc tcgacagacc ctctgcccca ggaggtacac      2040
     attcgaccaa gtcagcaaaa gtttgaaacc agtcaagccg gcttggagat catccgttgg      2100
     tcccagtatt ctctcgcaac tttaaaccgc cagataatcc tggtgctttc tgcattggga      2160
     atcccagatg aagtcttcca tagtaaactc aataccatgt tgggtagctt ccatcgagcc      2220
     atgctcaatg attcgaaagc aatcaatctt ctccaaaagt acatcgatcc aaaccaaatg      2280
     accctaacct tagcccagat ggtatctgat ggcttccgac gaaatgagga gccgtttgtc      2340
     aatacaatgc tcgagctctg gaaatcctgg catctcaagc accttaaaga gaaagcaaag      2400
     attgccatag accaaggagc caatgttctc ggtgtcatgg atgagacagg tgttttgaag      2460
     ggctacttta gaaaagaatt acccagcaga agagcctcgt atgcagagaa actggccgct      2520
     cttcctgaga tatttgtgca ggtctgccgg ctagatggag gtggtgagta tgaagtcatt      2580
     gaaggtctct gcattctggc acgcaaccct tcgcttcacc ctggagatat ccgtgtggtt      2640
     cgagcagtaa accgatcaga gctgcacgca ctccgggacg tggttgtgct tccccaaact      2700
     ggcgaccagg acattgcgag catgtgctcc gggggtgatc tcgatggtga tgactacctc      2760
     gttatttggg accccaatct gatccccgca aactggttcg tcgagtgcat ggactacaag      2820
     ggttccaaag cgccagacct tgatcatgat gtgactgttg atgagatcac ttcattcttc      2880
     gtcacctata tgaagaatga ctgccttccc cgaattgcgc acgctcattt agcttgggct      2940
     gacagactcc cgaggggcgt ttgggaagac aagtgcattc gtctcgccca gcttcattct      3000
     gatgcagtgg actataacaa gagcggtgcg catgcgagga tggcccgctc tctggatccc      3060
     aagttctggc ctcatttcat ggaaaagcgg ttcaagagac catccagcat ttacaagtcg      3120
     accaaaatcc tcggtcaact ctacgacgca gtgataacgc ctgacttcgt tcccaagcta      3180
     gagaagccct tcgactctcg cattcttgaa tccccgctgg ctccggcaag tgaggcctac      3240
     atggagtacg cccgtgagct caaggcggaa ttcgacatga acatgcgaca aatcatggct      3300
     cagtacgaga ttaacactga gtttgaggtg tggtcaactt ttgtgcttcg ccacggcttc      3360
     gtgatcaagg actacaagat gcaggaagac ctaggcagga tcgtgggcac actccgccgc      3420
     ggattccgcc accagtgcta tgacaaagtc ggccgtgatg gtggaaacat tcctgccttg      3480
     gtcatcgcca tgtatcgcgt tacccaggaa caggtagccg cagcactgga ggctcggcgc      3540
     aatgaggcac tgcagagaga agatgtttcg attgctgaag tgaactctac tgagcttccg      3600
     ctcattagct tcccttggat tttccctgac gtcctcggtg atgttgcgac gggccgggcg      3660
     cgacaggcca tgatctcaga cggacaagag agcgctgatt ctgcgaagcc tatcggcgag      3720
     ggtttggtct tcactcacaa gcagatcctc aagattgttg aggatatgga tggggacatc      3780
     aaatcgaccg ctgagaacat gaagctgaag gatccgaaga atatggagcc gaaggctgag      3840
     gcgggctcta actccgcacc tcccgatcaa gaactcattg ctcgtcggcg cattgacaaa      3900
     accaagccca aacaaaaatc cgaagacaga gatacgggtt tgtatatcga ggaggatgat      3960
     gagaaggagg gaggcgtagc cataggctct gcgaaaactg aagagaagat cgacaagaga      4020
     gaggctgtaa cggaggatat tgtggaaatg gagggcgacg tgaagccttc agcgcttgac      4080
     gatctgatca aaatgatcgg cggctga                                          4107
//

If you have problems or comments...

PBIL Back to PBIL home page