(data stored in SCRATCH zone)

EMBL: AM920435.PC20G02970

AM920435.PC20G02970  Location/Qualifiers
FT   CDS_pept        685215..686627
FT                   /gene="Pc20g02970"
FT                   /locus_tag="PCH_Pc20g02970"
FT                   /note="Title: strong similarity to pre-mRNA splicing factor
FT                   hSLU7 - Homo sapiens"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g02970"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85626"
FT                   /db_xref="GOA:B6HF57"
FT                   /db_xref="InterPro:IPR021715"
FT                   /db_xref="InterPro:IPR039974"
FT                   /db_xref="UniProtKB/TrEMBL:B6HF57"
FT                   /inference="similar to AA sequence:TREMBL:BC010634.1"
FT                   /protein_id="CAP85626.1"
FT                   /translation="MSRKPADVASKTPNEYIPSFISKKPFYVDDETNNDYLEHQRLQKA
FT                   TPDQSKWYDRGKRAGPAATKYRKGACENCGAMTHKTKECLSRPRKQGARWTGKDIQADE
FT                   LIQKVDMGWDAKRDRWNGYDATEYRQVVEEYEEMEAIKRMAKENSDLKKLQAGEDGDEG
FT                   PDSDIRYAEESDMGRQQSTATRNLRIREDTAKYLLNLDLDSAKYDPKTRRMVDMGAQDD
FT                   QAAALVAEENFVRASGDAAEFEKAQKYAWESQEKGLPQIHIQANPTSGEVLRKKEMVDS
FT                   EAKREAHRKALLDKYGGVEYTKPNALRETMVVENERFIEYDESGAIKGAPKNATKSKYP
FT                   EDVMVNNHSSVFGSWWYQFKWGYACCYSTVKNSYCTGEDGKKAFEEEGNMLMMTGAADD
FT                   NDEISDNAGNANLSHESEQADDRGQEQDSNTNGKKRTLEELKSGVTEEEYESYKRSRLA
FT                   AEDPMANFIGKD"
     atgtcacgaa aacccgcaga tgtggcgtca aaaacgccca acgagtacat tccatccttc        60
     atctcgaaaa agccattcta cgtcgacgat gagacaaaca acgactacct ggagcatcaa       120
     cgtcttcaga aagccactcc tgatcagtca aaatggtatg atcgaggaaa gcgtgcgggt       180
     ccagcagcca ccaaataccg caaaggcgca tgtgaaaatt gcggcgcgat gacacacaag       240
     accaaagagt gtctgagtcg accccgaaag caaggcgccc gatggactgg aaaggatatt       300
     caggcagacg aacttatcca gaaggtcgac atggggtggg acgccaaaag agatcggtgg       360
     aacgggtacg atgccacgga atatcgccag gtcgtcgagg aatatgaaga gatggaggcc       420
     attaagcgaa tggcgaagga aaattcagat ctcaagaaac ttcaagccgg tgaggatggc       480
     gacgaaggcc ccgattcgga tatccggtat gccgaagaat ccgacatggg acgacaacag       540
     agtaccgcca cccgcaacct acgtattcga gaagacaccg ccaaatactt gctgaacttg       600
     gaccttgatt ccgccaaata tgacccgaaa acacgccgaa tggtggacat gggtgcgcag       660
     gatgatcagg ccgctgcact tgtcgcagag gagaatttcg tccgtgcttc aggcgatgct       720
     gcggagttcg agaaagccca gaaatatgcg tgggagtcac aagagaaagg tctccctcaa       780
     atacatatcc aagccaatcc gacatctgga gaagttctcc gaaagaagga gatggttgac       840
     agtgaagcta agcgcgaggc gcatcgcaaa gctctcctgg ataaatacgg tggtgtagag       900
     tacacaaaac caaatgcact gcgagagact atggtcgttg aaaacgagcg attcattgag       960
     tatgatgaga gcggtgccat caagggcgcg cccaagaatg caaccaaatc caagtacccc      1020
     gaagatgtga tggtcaacaa tcattcttcg gtcttcggca gctggtggta ccaattcaaa      1080
     tggggatatg catgctgtta ttccactgtg aagaacagct actgtacagg ggaagatgga      1140
     aagaaggcct ttgaggaaga aggcaatatg ttgatgatga ctggagcagc cgacgacaat      1200
     gatgagattt ccgacaatgc tggaaatgcg aacctctccc acgagtctga acaagccgac      1260
     gacaggggtc aagagcagga ttcaaacacc aatggtaaaa agcggacgct ggaagaattg      1320
     aagtcgggtg tcacagagga ggaatatgaa tcgtacaagc ggagccggtt ggctgctgag      1380
     gatcctatgg ccaacttcat agggaaagat tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page