(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03020

AM920435.PC20G03020  Location/Qualifiers
FT   CDS_pept        join(696233..696761,696870..697078)
FT                   /gene="Pc20g03020"
FT                   /locus_tag="PCH_Pc20g03020"
FT                   /note="Title: weak similarity to hypothetical transcription
FT                   regulator SC5F2A.29 - Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03020"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85631"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE5"
FT                   /inference="similar to AA sequence:PIR:T35271"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /inference="protein motif:COGS:COG4977"
FT                   /inference="protein motif:COGS:COG0693"
FT                   /protein_id="CAP85631.1"
FT                   /translation="MSSPLRIGVLLVGTVQLLDLSAVDLLYMTTPEYLQECSLPRPLVD
FT                   LGRPCEIHYIAHNANDTAKTTAQMSLQLTDSLTDSAVSPGKLDIVLIPGPPPKAMPPPE
FT                   EYLDFVRAHFAAGAPILSVCTGAYVIGHAGITKGREVTAPRLLIPEMRRKFPEAKLWDD
FT                   SVRVARDGNLWTSGGITNGHDLVAGYLREHYPAALVNTILVAADIPSRPAAYATPAVSD
FT                   TLYILWQIIRAVPNAVVGWFRGR"
     atgtcatccc ccctccgcat cggcgtcctc ctcgtaggaa ccgtccaact cctcgacctg        60
     tcagccgtcg acctcctcta catgacaaca cccgaatacc tacaagaatg ttccctccca       120
     cggccactag tagacctagg ccggccctgc gagatccact acatcgccca caacgcaaac       180
     gacacagcca aaacgaccgc gcaaatgtcc ctacaactaa ccgactcact cacagactca       240
     gccgtttccc cgggcaagtt ggatatcgta ctcatccccg gcccaccgcc caaagcgatg       300
     ccaccaccag aagaatacct ggactttgtg cgcgcgcatt tcgcagccgg cgcgccgata       360
     ctgagtgtct gcacgggggc ctatgttatc ggacacgctg ggattacgaa gggacgggaa       420
     gtgactgcgc cgcggttgtt gattcctgag atgaggagga agtttcctga ggcgaagttg       480
     tgggatgatt cggttagggt tgctagggat gggaatttgt ggactagtgg cggaattaca       540
     aacggacacg atctggtcgc tgggtacctg cgtgaacatt accctgccgc tctggtgaat       600
     acgatcctcg tcgctgcgga cattccttcc cgtcccgcgg cgtatgctac tcctgccgtg       660
     agcgatactc tctatatcct atggcagatt attagggcag ttccgaacgc agtggttggg       720
     tggtttaggg ggaggtga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page