(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03060

AM920435.PC20G03060  Location/Qualifiers
FT   CDS_pept        join(705768..705817,705874..705920,705990..706091,
FT                   706238..706359,706412..706613,706669..706787)
FT                   /gene="Pc20g03060"
FT                   /locus_tag="PCH_Pc20g03060"
FT                   /note="unknown EC_number=3.1.5.1"
FT                   /note="Title: strong similarity to GTPase Rho3
FT                   -Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03060"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85635"
FT                   /db_xref="GOA:B6HFE8"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE8"
FT                   /inference="similar to AA sequence:PIR:S49891"
FT                   /inference="protein motif:PFAM:PF00071"
FT                   /inference="protein motif:COGS:COG1217"
FT                   /inference="protein motif:COGS:COG0481"
FT                   /protein_id="CAP85635.1"
FT                   /translation="MQLCGRQKVVQRKMVLLGDGACGKTSALNVFTPSSPRFSKKFYYL
FT                   QKHTSKCRLLTLVIGCTQRAYNIFVDNIHVELSLWDTAGQEEFDRLRALSYEDTHVLML
FT                   CFSVDSPDSFENVSSKWIAEINENCPGVRVVLTALKCDLRKDEDMNENPNTISFDQGLA
FT                   KAKEIGAVKYLECSAVQNRGIRESFYEAAKVALEVNAGGSSSSGSQCIIQ"
     atgcagctgt gcggccgtca gaaggtggtc cagcgcaaga tggtgctgct aggcgatggt        60
     gcctgcggca agacgtctgc gctgaatgtg tttactcctt cttccccacg gtttagtaag       120
     aaattctact atctccaaaa gcatacttcc aagtgcaggt tactgactct ggtcattggt       180
     tgtactcagc gagcctacaa tatcttcgtc gacaacatac atgtggagct ctcgctatgg       240
     gataccgccg gccaagaaga gttcgaccga ctgcgcgcgc tgtcttatga ggacacacat       300
     gtgctcatgc tctgcttcag tgtcgacagc cctgattcct tcgagaacgt atcgtcgaaa       360
     tggatcgccg agattaatga gaactgccct ggcgtgcgtg tagtcctgac agcgctcaaa       420
     tgcgatctgc gcaaggacga agacatgaat gagaacccca acaccatcag cttcgaccag       480
     ggcctagcga aagcaaagga gatcggcgcc gtgaagtacc tggagtgctc cgccgtccaa       540
     aaccgcggca tcagagaaag cttctacgag gcagctaagg ttgccctcga ggttaacgcg       600
     ggcgggagct cgtcttctgg ttcgcagtgc atcattcagt ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page