(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03080

AM920435.PC20G03080  Location/Qualifiers
FT   CDS_pept        complement(join(709087..709698,709763..709879))
FT                   /gene="Pc20g03080"
FT                   /locus_tag="PCH_Pc20g03080"
FT                   /note="Title: strong similarity to hypothetical GTPase
FT                   activating protein homolog GAP1 - Cochliobolus
FT                   heterostrophus"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03080"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85637"
FT                   /db_xref="GOA:B6HFF0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF0"
FT                   /inference="similar to AA sequence:TREMBL:AF027687.2"
FT                   /protein_id="CAP85637.1"
FT                   /translation="MAESLNPPLSYEASATTTHPHVATSLPSEVIACLKNSRFLHLATC
FT                   DDKTPHISLMSYTYLPSTPFDPHPIIIMTTNPASRKTNHLLSNPRVSLLVHDWVSHRPP
FT                   TRAPTQGDREGSPPPAATRSSLASLLLNLNTSALSSISTTITGEAQFLEPGSEEESWCK
FT                   ARHLENNTFEEEEINLFGQQQQQDPSARRPSLSIDTDVRVVTVRVTEGRIADWKGGVRD
FT                   WVLLPAEQQDAGLVNGVASS"
     atggcggaat cactcaatcc cccgctgtct tacgaggcat ctgccaccac cactcatcct        60
     catgtcgcta cctcattgcc atccgaggtc atcgcgtgtc ttaagaattc ccgcttccta       120
     cacctggcaa catgtgatga taaaacaccc cacatctcac tgatgtccta cacctatctc       180
     ccctcgaccc cattcgaccc gcaccccatc atcatcatga ccacaaaccc cgcatcgcgg       240
     aaaacgaacc acctgctgtc caacccgcga gtctcattgc tggtccacga ctgggtgtcg       300
     catcgcccac caacccgggc cccgacgcaa ggtgaccgcg agggctcacc accgcccgcc       360
     gctacccgct cgtctcttgc cagcctgcta ctcaacctga acaccagcgc gctctccagc       420
     atctcgacta ctattacagg cgaggcgcag ttcttggaac caggctcgga ggaggagtca       480
     tggtgcaagg ctcgccattt ggagaataat actttcgagg aagaggagat caatctcttc       540
     ggccagcagc agcaacagga tcctagcgcg agacggccta gtctttccat tgacactgac       600
     gtgcgagtcg ttactgtaag agtcaccgaa ggtcgtattg cggattggaa gggtggtgtc       660
     cgcgactggg ttctgcttcc tgccgagcag caggacgctg gactggtcaa tggcgtggcc       720
     tcttcatag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page