(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03090

AM920435.PC20G03090  Location/Qualifiers
FT   CDS_pept        complement(join(710322..710407,710503..710606,
FT                   710688..710771,710846..710922))
FT                   /gene="Pc20g03090"
FT                   /locus_tag="PCH_Pc20g03090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03090"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85638"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFF1"
FT                   /protein_id="CAP85638.1"
FT                   /translation="MRLTNDESEVDNKLGRRIKWEEEEEELKLQGRGRVEEGAMIGVGV
FT                   PIRSESMRITPSQYHVGMSGDAVDFILLNGSCLCAGKELPRVLDVLGTIGLPQATACTW
FT                   NSVLRTSPLIRD"
     atgcgcttga caaatgatga atccgaggtt gacaataagc tagggaggag aatcaagtgg        60
     gaagaagagg aagaagagtt gaagttgcag gggagaggga gagttgaaga aggggcgatg       120
     atcggggtgg gtgtaccgat cagatcggag agtatgagaa ttactccaag tcagtatcac       180
     gttggaatgt caggagatgc cgttgacttc atattgttga acggtagctg tttatgtgcg       240
     gggaaggagc ttccccgagt tctcgatgta cttggtacta ttggacttcc gcaagccact       300
     gcatgtactt ggaatagcgt cctccgtaca tcgccactta ttagggacta g                351
//

If you have problems or comments...

PBIL Back to PBIL home page