(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03210

AM920435.PC20G03210  Location/Qualifiers
FT   CDS_pept        complement(join(735132..735455,735516..735773,
FT                   735831..736652))
FT                   /gene="Pc20g03210"
FT                   /locus_tag="PCH_Pc20g03210"
FT                   /note="unknown EC_number=3.1.3.3"
FT                   /note="Title: strong similarity to phosphoserine
FT                   phosphatase Ser2 - Saccharomyces cerevisiae"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85650"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ2"
FT                   /inference="similar to AA sequence:PIR:S53931"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /inference="protein motif:COGS:COG0560"
FT                   /protein_id="CAP85650.1"
FT                   /translation="MAESTRTTRPSLGQMRSSSFLQDHQQYKPMAPINPISQTIGEVLA
FT                   NQTEDQLVLNSNPIKPDPERVTDSGIIHSIFNHQANPLPTGTSQVVATIYYKSNNPVHP
FT                   HYHPDSGPQNVPGDKIPAPKVPEGSAPTEDMDKFPREPPAPEPEPLDHLYGPYVSQLCL
FT                   TNFLQILETLPTPYQRMNTSHRCLDRDEHPRVVEVTFSPPPNPEYLSFPDLRKHESIWR
FT                   FEREWNVEVVLQKESVFRRHKRLAVFDMDSTLIDNECIDEIAKFIGVEKEVSEITERAM
FT                   NGELDFTASLKERVGLLNGVSADVFEKLKSVLKIAKGARELCRALKALGYKIAVVSGGF
FT                   QPLAEWLAGQLGIDIAIANHLEIDEATQTLTGKLVPSYPIVDAAHKRTLLKSIAAENGI
FT                   PLSQTMAVGDGANDLLMLHAAGLGVAWRAKSKVQLEAPVRINGESLVDVLYLLGMDNED
FT                   IAELTSDVQ"
     atggcagagt ctacccgcac cacgaggcca tccctcggcc aaatgcgcag cagttcattc        60
     ctgcaggacc accagcagta caagccgatg gctccaatca atccaatcag tcaaaccatc       120
     ggtgaggttc tggctaacca gacagaagat caactggtac ttaactcgaa tccaatcaag       180
     cctgatccgg agagggtcac cgacagcggc atcattcaca gcattttcaa ccaccaagca       240
     aatccccttc caaccggcac atcgcaagtc gtcgcgacca tctactacaa atccaacaac       300
     cccgttcacc cccactacca tcccgactca gggcctcaga atgtcccagg cgacaagatc       360
     ccagctccta aggtgcccga aggctctgcc ccgacagaag acatggataa attcccacgg       420
     gagccgcctg ccccagagcc cgagccactg gatcacctat acgggccata cgtctctcag       480
     ctgtgcttga ccaacttcct tcagatcttg gaaacccttc ccacgcccta ccagcgcatg       540
     aacacctcgc accgctgtct tgaccgcgac gaacaccccc gcgtcgtgga ggtcacattc       600
     tctcccccgc caaacccgga atatctctcg ttcccggatc tacgcaagca tgagagcatt       660
     tggcgctttg agcgcgagtg gaatgtcgag gttgtcctgc aaaaggagag cgtcttccgt       720
     cgtcacaagc gcttggctgt tttcgacatg gacagcacat tgattgacaa cgagtgcatc       780
     gatgaaattg ccaagttcat cggtgtcgag aaagaggttt ccgaaatcac tgaacgtgcc       840
     atgaacggcg aactagactt caccgcatca ctaaaggaac gtgtcggtct tctcaatggc       900
     gtctccgcag atgtcttcga gaagctcaag tccgtcctca aaatcgcgaa gggtgcccgt       960
     gagctctgcc gcgcattgaa ggctctgggc tacaagatcg cagtagtgag cggcgggttc      1020
     cagcccctcg ccgaatggct cgccggacag ctcggtatcg acattgccat tgccaaccat      1080
     ctcgaaatcg acgaggccac ccagaccctg accgggaaat tggtgccgtc ctaccccatc      1140
     gtcgacgccg cgcacaagcg cactctcctc aagtccatcg ccgccgagaa cggcattccc      1200
     ctctcgcaaa caatggctgt cggcgatggc gccaacgacc tcctgatgct ccacgctgca      1260
     ggcctcggcg tcgcctggcg cgctaagtcc aaggtccagt tggaagctcc cgtccgcatc      1320
     aacggcgaga gccttgtcga tgtcctctac cttctcggca tggacaacga ggacatcgcg      1380
     gagttaacct ccgatgtcca ataa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page