(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03260

AM920435.PC20G03260  Location/Qualifiers
FT   CDS_pept        complement(join(745826..746101,746265..746311,
FT                   746367..746418))
FT                   /gene="Pc20g03260"
FT                   /locus_tag="PCH_Pc20g03260"
FT                   /note="Title: similarity to hypothetical protein mlr1783
FT                   -Mesorhizobium loti"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03260"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85655"
FT                   /db_xref="GOA:B6HFQ7"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ7"
FT                   /inference="similar to AA sequence:TREMBL:AP002998.97"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /inference="protein motif:COGS:COG3791"
FT                   /protein_id="CAP85655.1"
FT                   /translation="MALTGSCMCGGITYTVEADTYLSALCHCTDCQKFLTPLFHTGATK
FT                   NYDVVGNSGKINKHFFCPTCGSGLYTELEVMPDNTVIKAGTLDGGEANLKGKIDVEFYV
FT                   KDRPTYLAAVEGAKQEPMFG"
     atggctctca cgggaagctg catgtgcggc ggtattactt acaccgtcga agctgacact        60
     tatctgtccg ccctgtgcca ctgcaccgac tgccagaagt ttttaactcc cctcttccac       120
     acaggtgcca ccaagaacta cgatgtagtt ggcaacagtg gaaagatcaa caagcacttt       180
     ttctgcccca cctgcggttc aggtctctac acagagctgg aggtcatgcc cgacaacacc       240
     gttatcaagg ccggaaccct cgacggcggc gaggctaatc ttaaaggaaa gattgatgtc       300
     gagttctatg ttaaggaccg tccgacctac cttgctgctg tggagggtgc taagcaggag       360
     ccgatgtttg gttga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page