(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03270

AM920435.PC20G03270  Location/Qualifiers
FT   CDS_pept        complement(join(747097..748638,748699..748855,
FT                   748914..748969))
FT                   /gene="Pc20g03270"
FT                   /locus_tag="PCH_Pc20g03270"
FT                   /note="Title: strong similarity to myocyte-specific
FT                   enhancer factor like protein An02g12210 - Aspergillus
FT                   niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03270"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85656"
FT                   /db_xref="GOA:B6HFQ8"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR033896"
FT                   /db_xref="InterPro:IPR036879"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFQ8"
FT                   /inference="protein motif:PFAM:PF00319"
FT                   /inference="protein motif:COGS:COG2319"
FT                   /inference="protein motif:COGS:COG5068"
FT                   /protein_id="CAP85656.1"
FT                   /translation="MGRRKIEIKAIKDDRNRSVTFLKRKGGLFKKAHELAVLCSVDVAV
FT                   IIFGHNKKLYEYSSCDMHDALGRYQYFGPPHEHKGPEDFAGKRDDDDEEDEASPAPEDI
FT                   QAVQQNHPAIPPHLQSQPAFQHMNHAPSASPPIHHAMTRHGTPQPQGTSRPSSRNHIRR
FT                   VSSNLGPQQHGTPPPPPPPGPQNGGFTYMPNPSMYNPNVHAMNQQPRPAQFAHYGHPPG
FT                   QHQGTPPMHPHGLPQQMPPQHQGQQHFQHGHPVGMPPGPHQHVQQAYMQEHGRNSMPPG
FT                   FAPDHQERPASEHPQDDSVMKAEHSQSPPQIKSLSKSRSIFTPIDDRGSVLARHFGAGA
FT                   GSYESHNSHSLKVEAPQASIASKSMPVRAATEAPRAGSIASTPKIKPPSRTNSGPLPSK
FT                   RPQLKVQIPSETSDAGSATADSSHDSAVNKNSPPAKGNVENGPPGVVLPPPSPSAGAIL
FT                   SAGAQGPPNPFARPPPPVAATRNDSYGSNSGNPNNGNNSNNIETPISALPSRFVSDALL
FT                   PSPSSFFPEWGFGRSGPDSNMLPSPLTFPTPAVQSGPSFSREDEQDKKRKSPDSGSAGE
FT                   GAHKKPKT"
     atgggtcgga gaaagatcga gatcaaggct atcaaagatg accgcaaccg ctcggtcaca        60
     ttcctgaaac gaaagggagg tctgttcaag aaggcgcatg agcttgctgt cctttgctcg       120
     gttgacgtcg ctgtcattat ttttggccac aacaagaaac tatacgagta ctcatcatgc       180
     gacatgcatg atgctcttgg tcgctatcaa tattttggcc ctccccacga acacaaagga       240
     ccggaagatt ttgcgggcaa gcgagatgat gatgatgagg aagacgaggc ctcgccggct       300
     cccgaggaca tccaagcagt tcaacagaac caccccgcca ttccccctca tctccaaagc       360
     cagcctgcct tccagcacat gaatcatgca ccctccgcgt cacccccgat ccatcatgct       420
     atgacacgtc atggcacccc gcaaccgcaa ggcacttcgc gtccctcttc caggaatcat       480
     atccgccgag tcagttcaaa tctaggtcct cagcaacatg gtacacctcc accgccgcca       540
     ccacctggcc cccagaatgg cgggtttacg tacatgccta atccctccat gtataacccc       600
     aacgttcatg cgatgaacca gcaacctcga ccggcacagt ttgcacacta tggacaccca       660
     ccgggacaac atcaagggac gcctcctatg cacccgcacg gtttaccaca gcaaatgcca       720
     ccgcaacacc agggccaaca gcatttccaa cacggccacc ccgtaggaat gcccccgggg       780
     ccccatcaac atgtgcagca ggcatatatg caggaacatg gaagaaattc tatgcctcca       840
     gggttcgcac ctgatcacca agaacggcct gcctcggagc atccccagga tgattcggtg       900
     atgaaagcag aacacagcca gtcgccaccg caaataaagt cgttatcgaa atcacggagt       960
     attttcacgc ctattgatga tcgaggatcg gtgctcgccc gccattttgg agccggagcg      1020
     ggatcatatg aatctcacaa tagccattct ctcaaggtcg aagcaccaca agcttcgatt      1080
     gcttccaaat cgatgcctgt cagagctgcg acggaggctc ctcgggcagg gtcaattgct      1140
     tcgacgccaa aaatcaaacc gccatcccga actaacagtg ggccgttgcc atccaaacga      1200
     ccgcagctga aggtgcagat ccctagcgaa acctccgatg ctggcagtgc cacggccgac      1260
     tcgtcacatg attccgccgt gaataagaac tcgccgcctg cgaaaggaaa tgtcgaaaat      1320
     ggcccgccgg gcgtggtttt accccctccg tcgccatccg ccggtgcaat attgagtgcg      1380
     ggagcccaag ggcctccaaa tccgttcgcc cgaccgcctc ctcccgttgc cgcaacgcga      1440
     aacgactctt acggcagcaa tagcggaaat ccgaacaatg ggaataactc gaataacatc      1500
     gaaacgccca tatctgccct gccgagtcgc tttgtatccg atgcactcct cccgtcacct      1560
     tccagcttct tccccgaatg gggctttggc cggtcaggcc ctgactccaa catgctgccc      1620
     agtcccctca ccttcccgac tccggcagtg caaagcggtc ccagcttttc tcgagaagac      1680
     gaacaagaca agaagagaaa aagccccgac agtggatccg caggggaagg tgcacataaa      1740
     aagccgaaaa cctga                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page