(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03400

AM920435.PC20G03400  Location/Qualifiers
FT   CDS_pept        complement(join(779515..779618,780107..780235,
FT                   780306..780495,780588..780797,780883..781218))
FT                   /gene="Pc20g03400"
FT                   /locus_tag="PCH_Pc20g03400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03400"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85669"
FT                   /db_xref="UniProtKB/TrEMBL:B6HG27"
FT                   /protein_id="CAP85669.1"
FT                   /translation="MTASPPSTSGTSTSTCNPYGSFLRGILAEISAMRGLRISRYYAEP
FT                   GRGYTPSDKSGRDCGADQLVALRSWVTIQCISFPRTRLAVERWIRRGALLRMLKVARVS
FT                   IDFTVEDVRRIMAKTANTATSRTSPARLYELRTSYSYIPLPAREHTQIAFAVHKAIDKA
FT                   LARMGLDEATHDYLGVDIDQIGIQQDLHLWRYPRPSRPSRQNDLLNKHIVHPSIGNVGE
FT                   NLGLQAELQSGGSYFAAVFEDTARLSIGELRVRQGTSFIATRKEGELFYPAATGKELLK
FT                   YLGWGSPCTRSKEYGPYDQVIGRVVASAKVTGTKEIETARL"
     atgaccgcat cacctccatc aacgagtgga acaagcacat ctacgtgtaa cccatatgga        60
     tccttccttc gcggtatcct tgcagagatc tcagccatga ggggccttcg gatctcccga       120
     tattacgctg agcctggccg aggctacaca ccatcagaca aatcgggcag agactgcggt       180
     gccgatcaac tggtcgcact taggagctgg gttactatcc agtgtataag cttcccccga       240
     acgcgtcttg cggtggagag atggatccgc aggggcgcgc ttctgaggat gctcaaagtt       300
     gcaagagtga gcattgactt cacagttgaa gatgtgagac gtataatggc gaaaactgcc       360
     aacactgcaa caagtcgcac aagccccgcg agactgtatg aacttcgaac ttcttatagc       420
     tatatccctt tgcctgctcg cgagcatacc caaattgcct tcgcggtgca caaagccatc       480
     gataaggccc tggcacgaat gggacttgac gaagccacac acgactacct aggagtcgat       540
     atcgatcaga taggaatcca gcaagacctg catttgtggc gttacccgag accttcaaga       600
     ccaagcaggc agaatgacct gctgaataag cacattgttc atccatccat aggtaatgtt       660
     ggggaaaacc ttggtctgca agcggagtta caatctggag ggtcttattt cgctgcagtt       720
     ttcgaagaca cagcaagact ctctattgga gagctaaggg tgcgacaggg gacttcattc       780
     atcgccactc ggaaagaggg cgagttgttc tatcccgcgg caaccggaaa ggagcttttg       840
     aagtacctcg gctggggatc cccatgcact aggagcaaag agtatggtcc gtatgatcag       900
     gtgattggta gggttgttgc cagcgccaag gtcacaggga caaaagagat tgaaacggct       960
     agattatga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page