(data stored in SCRATCH zone)

EMBL: AM920435.PC20G03520

AM920435.PC20G03520  Location/Qualifiers
FT   CDS_pept        join(806736..806768,806830..807354,807404..808984)
FT                   /gene="Pc20g03520"
FT                   /locus_tag="PCH_Pc20g03520"
FT                   /note="Title: weak similarity to hypothetical protein
FT                   An02g12290 - Aspergillus niger"
FT                   /db_xref="EnsemblGenomes-Gn:PCH_Pc20g03520"
FT                   /db_xref="EnsemblGenomes-Tr:CAP85681"
FT                   /db_xref="UniProtKB/TrEMBL:B6HGF0"
FT                   /protein_id="CAP85681.1"
FT                   /translation="MVAPSLAVTEFERPSRRVQGTFLMESNNPIYQWLSTVEDQRQSML
FT                   SKRLRSLRANRALAENQEQVKDTALATGIPRIHIPLETSDDLRANGHSASRKRDSRHLK
FT                   ETKASSTHDTIPGSEGHKRSRNCYELRPRYKTREDRYEYKGPSSAVETQSQSRKGRAKK
FT                   PRGRRHTMNDDFRAINVTGNRLTLRSNTNLGIFNKGRSSSVANQRGNTPTGLAKPASVT
FT                   RSQMYVTESDLAFSEMNFLSRRNNLNHPISTVRETLDGQHEREYHPQVQFDDPAHDCNL
FT                   GTSHSIHKLVDVKCKLDDSAMPLFAFEEAPASEISPVFGHSRSASPMPPNKRRKISKQS
FT                   SSIPYTWTETEIDDTEQSDALEQHLLNLLHVGVYPQALCSEIKNTVLTGQYWSLAELWE
FT                   LLKERKASWSNEAGRQIRASPEASTGQLAAVDASLQEVREVIAPGHSDVPSAGSVQNEM
FT                   SKQSADSNVACETACSVNSPPKQSSGLEQQQDRPHEASDKPGPPSLQAARTSNSPDRFI
FT                   DTLNEDQGEPSHQESAEDAVHFPASVPDVEHPHMSDIEFYELGRVDDDDVFYRTLDAAY
FT                   CAIVSPEVAAEVASDLQELLESPELNGNDLPNTPESTNIREPDIPTGQAEVAEPEYLVK
FT                   VSQDIIQNRYDGRPSEPSCQRKLSTSHLNDPCVDQNNELPWVATGYGQTQPRASTGIDA
FT                   GQAKPPGLSGFWRQNRLY"
     atggtcgcgc cttctttggc ggtgactgaa tttgaacggc ccagtcgcag agtccaagga        60
     actttcttga tggagagcaa taatccaatc tatcagtggc tttccactgt ggaggaccag       120
     agacaaagta tgctgtcaaa aagactacga agcttacgcg ctaacagagc tttagctgag       180
     aaccaggaac aagtgaagga cacagctctt gcaacgggaa taccacggat ccacatccca       240
     cttgagacat ctgatgacct gcgtgcgaat ggacattcag ctagcaggaa gagagattca       300
     cgtcacctca aggaaacgaa agcatcatcc actcatgaca ccataccagg gagtgaaggt       360
     cataagagat ctcgaaattg ttacgagcta aggcccagat acaagactcg cgaggatcgc       420
     tatgagtaca aaggcccatc atcggctgtg gagacccagt cgcagtctcg caaaggaaga       480
     gccaaaaagc cccggggcag gaggcataca atgaatgacg acttccgtgc catcaatgtc       540
     acaggaaaca gattgacact gcgcagcaat acgaacctgg gtatattcaa caaaggacgg       600
     tcttcttctg tggccaatca gcgcggaaac accccaaccg gacttgcaaa acctgcatca       660
     gtcaccaggt ctcagatgta tgtcacagaa tccgatcttg ccttttctga gatgaacttt       720
     ctgtcccgga ggaataatct caaccatcct atatcgactg tcagagaaac tctggatgga       780
     cagcatgaga gagagtacca tccacaggta cagttcgatg accctgcaca cgactgcaat       840
     ctcggcacgt ctcactcaat tcacaaattg gttgatgtga aatgcaagct tgacgactca       900
     gccatgccgc tgttcgcatt tgaagaggct ccggccagtg agatatcccc agttttcggt       960
     cactcccgga gtgcttcccc catgccaccc aataaaagaa ggaagatatc aaaacaatca      1020
     tcatctattc catacacttg gactgaaact gagatcgacg acactgaaca aagcgatgcc      1080
     cttgaacaac acctgctgaa cctgctgcat gtcggagtat atccccaagc gctatgctcc      1140
     gagatcaaaa ataccgtctt gaccggacag tattggagtc tcgccgaatt atgggaactg      1200
     ctgaaggaga gaaaggcgtc atggtcaaac gaagcaggca gacaaattcg agcttcaccc      1260
     gaagccagca caggacagct agctgcagtc gatgcctctc tacaagaggt tcgcgaggtc      1320
     attgcaccgg gccattcgga tgttcccagt gccggtagtg tacagaacga aatgtccaaa      1380
     caatccgcgg attcgaacgt cgcctgtgaa acggcttgca gtgtgaatag tccacccaaa      1440
     caatcttcag gtctcgagca acaacaagac agaccacatg aagcttcaga taagccaggc      1500
     cctccaagcc tccaagctgc caggacatca aacagcccag accgtttcat agacaccttg      1560
     aatgaagatc agggtgagcc ttcccaccag gaatcggcag aggatgcagt ccatttccct      1620
     gcatccgtac cagatgttga acacccgcat atgtctgaca tcgaatttta tgagctgggc      1680
     cgagtcgatg atgatgacgt gttctatcgc acgctggatg ctgcttactg tgccatcgtg      1740
     agccctgagg tcgcggcgga ggttgcatca gacttgcagg agttacttga atcacccgaa      1800
     ctaaatggca atgatcttcc gaatactcca gagtcgacta atatccggga acccgatatt      1860
     cctaccggac aggcagaggt ggcagagcca gagtatttgg taaaggtctc ccaggacatc      1920
     atacaaaacc ggtatgatgg aaggccatct gagccttctt gccaacgaaa actatctacg      1980
     agtcatttga atgatccttg tgttgaccag aacaatgaat tgccatgggt ggctactgga      2040
     tacggccaga cacaaccgcg cgcgtcaact ggaattgatg cgggacaggc taagcctcca      2100
     ggattatctg gcttctggag acagaacaga ctctattga                             2139
//

If you have problems or comments...

PBIL Back to PBIL home page