(data stored in ACNUC7421 zone)

EMBL: AM946981.ARTI

AM946981.ARTI        Location/Qualifiers
FT   CDS_pept        complement(906955..907686)
FT                   /transl_table=11
FT                   /gene="artI"
FT                   /locus_tag="B21_00874"
FT                   /product="artI, subunit of arginine ABC transporter"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00874"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31391"
FT                   /protein_id="CAQ31391.1"
FT                   /translation="MKKVLIAALIAGFSLSATAAETIRFATEASYPPFESIDANNQIVG
FT                   FDVDLAQALCKEIDATCTFSNQAFDSLIPSLKFRRVEAVMAGMDITPEREKQVLFTTPY
FT                   YDNSALFVGQQGKYTSVDQLKGKKVGVQNGTTHQKFIMDKHPEITTVPYDSYQNAKLDL
FT                   QNGRIDGVFGDTAVVTEWLKDNPKLAAVGDKVTDKDYFGTGLGIAVRQGNTELQQKLNT
FT                   ALEKVKKDGTYETIYNKWFQK"
     atgaaaaaag ttctgattgc cgcgttaatt gcaggtttta gtctttccgc cacagctgcc        60
     gaaaccattc gttttgctac cgaagcctcc tatcctccgt ttgaatcgat tgatgcaaac       120
     aaccagatcg ttggttttga cgtcgacctg gcacaagcgc tgtgtaaaga gattgatgca       180
     acctgcactt tctctaacca ggcgtttgac agcctgatcc caagcctgaa attccgtcgc       240
     gtagaagccg tgatggcggg catggatatc actccggagc gtgaaaagca ggtgctgttt       300
     accaccccgt actatgacaa ctctgccctg tttgtgggtc agcaaggcaa atacaccagt       360
     gttgatcagc tgaaaggcaa aaaagtcggc gtacagaacg ggacgacaca ccagaaattc       420
     attatggata agcacccgga aatcactacc gttccgtatg acagctacca gaacgcaaaa       480
     ctggatctgc aaaacgggcg tatcgacggc gtcttcggtg acaccgcagt ggtcactgag       540
     tggctgaaag ataacccgaa actggcggcg gtgggcgaca aagtgaccga taaagattac       600
     ttcggcactg gcctcggcat cgcggtacgt cagggcaaca ctgagctgca gcagaaactc       660
     aacactgcgc tggaaaaagt gaagaaagat ggcacttacg aaaccatcta caacaaatgg       720
     ttccagaagt aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page