(data stored in SCRATCH zone)

EMBL: AM946981.BIOD

AM946981.BIOD        Location/Qualifiers
FT   CDS_pept        796257..796934
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="B21_00762"
FT                   /product="dethiobiotin synthetase monomer, subunit of
FT                   dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:B21_00762"
FT                   /db_xref="EnsemblGenomes-Tr:CAQ31279"
FT                   /protein_id="CAQ31279.1"
FT                   /translation="MSKRYFVTGTDTEVGKTVASCALLQAAKAAGYRTAGYKPVASGSE
FT                   KTPEGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVMSAGLR
FT                   ALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQLPVILVVGVKLGCINHAMLTAQAI
FT                   QHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEIPWLAENPENAATGKYINL
FT                   ALL"
     gtgagtaaac gttattttgt caccggaacg gataccgaag tggggaaaac tgtcgccagt        60
     tgtgcacttt tacaagccgc aaaggcagca ggctaccgga cggcaggtta taaaccggtc       120
     gcctctggca gcgaaaagac cccggaaggt ttacgcaata gcgacgcgct ggcgttacag       180
     cgcaacagca gcctgcagct ggattacgca acagtaaatc cttacacctt cgcagaaccc       240
     acttcgccgc acatcatcag cgcgcaagag ggcagaccga tagaatcatt ggtaatgagc       300
     gccggattac gcgcgcttga acaacaggct gactgggtgt tagtggaagg tgctggcggc       360
     tggtttacgc cgctttctga cactttcact tttgcagatt gggtaacaca ggaacaactg       420
     ccggtgatac tggtagttgg tgtgaaactc ggctgtatta atcacgcgat gttgactgcg       480
     caggcaatac aacacgccgg actgactctg gcgggttggg tggcgaacga tgttacgcct       540
     ccgggaaaac gtcacgctga atatatgacc acgctcaccc gcatgattcc cgcgccgctg       600
     ctgggagaga tcccctggct tgcagaaaat ccagaaaatg cggcaaccgg aaagtacata       660
     aaccttgcct tgttgtag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page